Contact Us
800.227.0627

[Gln22] - beta - Amyloid (1 - 42), E22Q Dutch Mutation, human

[Gln22] - beta - Amyloid (1 - 42), E22Q Dutch Mutation, human
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Gln - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - COOH
Catalog :
13798-005
Unit:
0.5 mg
Price/Unit:
$878  (For other quantities please Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Purity:
>95%
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is a naturally occurring mutant form of the wild type (WT) beta-Amyloid 1 to 42 peptide. The E22Q "Dutch" mutant, also known as HCHWA-D, is caused by a point mutation in the beta-Amyloid encoding gene, with Glu replaced by Gln at position 22. Dutch E22Q mutation in beta-Amyloid causes familial cerebrovascular amyloidosis with abundant diffused amyloid plaque deposits. E22Q mutant and WT peptides are both stable in "collapsed coil" conformations. The E22Q fibrils are more toxic for vascular cells than the WT fibrils.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
M.W.:
4513.1 g/mol
Reference/Citations:
  1. Massi, F. and J. Straub Biophys. J. 81, 697 (2001);
  2. Muñoz, F. et al. J. Neurosci. 22, 3081 (2002);
  3. Davis, J. et al. J. Biol. Chem. 279, 20296