Live Chat Support Software
800.227.0627

Antimicrobial and Related Peptides

 

Definition

Antimicrobial peptides (AMPs) are as widespread as bacterial inactivator molecules in the innate immune systems of insects, fungi, plants, and mammals. These peptides are also known as host defense peptides (HDPs) as they have other immuno-modulatory functions besides the direct antimicrobial actions and are even capable of killing cancerous cells 1,2.

 

Classification

Three broad categories of HDPs have been identified: 1) the linear peptides with helical structures, 2) the cysteine stabilized peptides with beta-sheet, and 3) a group of linear peptides rich in proline and arginine that primarily have been identified in non-mammalian species.

 

Structural characteristics

In mammals, cathelicidins and defensins are the two principal AMP families. Cathelicidins are peptides with a conserved proregion and a variable C-terminal antimicrobial domain. Defensins are the best-characterized AMPs, they have six invariant cysteines, forming three intramolecular cystine-disulfide bonds.

 

Mode of action

The mode of action of AMPs elucidated to date include inhibition of cell wall formation, formation of pores in the cell membrane resulting in the disruption of membrane potential with eventual lysis of the cell. These peptides also inhibit nuclease activity of both RNase and DNase.

 

Functions

They have a broad ability to kill microbes. AMPs form an important means of host defense in eukaryotes. Large AMPs (>100 amino acids), are often lytic, nutrient-binding proteins or specifically target microbial macromolecules. Small AMPs act by disrupting the structure of microbial cell membranes. It plays an active role in wound repair and regulation of the adaptive immune system. They have multiple roles as mediators of inflammation with impact on epithelial and inflammatory cells, influencing diverse processes such as cell proliferation, wound healing, cytokine release, chemotaxis and  immune induction 3.

 

 

References

 

1.     Gottlieb CT, Thomsen LE, Ingmer H, Mygind PH, Kristensen HH, Gram L(2008). Antimicrobial peptides effectively kill a broad spectrum of Listeria monocytogenes and Staphylococcus aureus strains independently of origin, sub-type, or virulence factor expression. BMC Microbiol., 8:205.

2.     Yeaman MR and Yount NY (2003). Mechanisms of Antimicrobial Peptide Action and Resistance.  Pharmocological Reviews, 55(1).

3.     Hanna Galkowska H and Olszewski WL (2003). Antimicrobial peptides – their role in immunity and therapeutic potential. Centr Eur J Immunol., 28 (3):138–141.

ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
5 - FAM - LC - LL - 37
5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
13998-001 0.1 mg $127 cart inquire
Ac - Lys(Ac) - D - Ala - D - Ala - OH
Ace-Lys(Ac)-aa
13999-5 50.0 mg $320 cart inquire
Alloferon 1
HGVSGHGQHGVHG
14000-01 1mg $183 cart inquire
Alloferon 2
GVSGHGQHGVHG
14001-01 1mg $183 cart inquire
Andropin
VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
10388-01 1 mg $245 cart inquire
Antimicrobial Anionic Peptide, Surfactant-associate
GADDDDD
10376-01 1 mg $220 cart inquire
Antimicrobial Anionic Peptide, Surfactant, ovine
DDDDDDD
10377-01 1 mg $220 cart inquire
Apidaecin IA
GNNRPVYIPQPRPPHPRI
10387-01 1 mg $240 cart inquire
Apidaecin IB
GNNRPVYIPQPRPPHPRL
10386-01 1 mg $120 cart inquire
Aurein 1.1
GLFDIIKKIAESI-CONH2
10385-01 1 mg $220 cart inquire
Bac2A; Bactenecin 2A
RLARIVVIRVAR-CONH2
14002-01 1mg $120 cart inquire
Biotin - LC - LL - 37
Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
14003-005 0.5 mg $286 cart inquire
Bombinin - like Peptide (BLP - 1)
GIGASILSAGKSALKGLAKGLAEHFAN-CONH2
10357-01 1 mg $325 cart inquire
Brevinin - 1
FLPVLAGIAAKVVPALFCKITKKC (Disulfide bridge: 18-24)
10358-01 1 mg $470 cart inquire
CAP-18, rabbit
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
10362-01 1 mg $340 cart inquire
CAP - 18, rabbit
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
10362-005 0.5 mg $226 cart inquire
Carnobacteriocin B2
VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP no bond
10381-005 0.5 mg $500 cart inquire
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-CONH2
10348-01 1 mg $286 cart inquire
Cecropin A (10348-005)
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
10348-005 0.5 mg $171 cart inquire
Cecropin B
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-CONH2
10349-01 1 mg $390 cart inquire
Cecropin B (10349-005)
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2
10349-005 0.5 mg $171 cart inquire
Dermaseptin
ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ
10380-005 0.5 mg $350 cart inquire
Dermcidin, DCD - 1L
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
14264-001 0.1 mg $138 cart inquire
[Des Ala20, Gln34] Dermaseptin
ALWKTMLKKGTMALHAGK
10379-01 1 mg $240 cart inquire
Drosocin
GKPRPYSPRPTSHPRPIRV
10396-01 1 mg $120 cart inquire
Elafin
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
14265-001 0.1 mg $232 cart inquire
GLU Construct
TGAQTIKGQKLYFKANGQQVKG
10391-01 1 mg $300 cart inquire
Glucosyltransferase I (442-462), Streptococcus mut
DANFDSIRVDAVDNVDADLLQ
10390-01 1 mg $300 cart inquire
HEL (46-61)
NTDGSTDYGILQINSR
10351-01 1 mg $270 cart inquire
Helicobacter pylori, Hp (2 - 20)
AKKVFKRLEKLFSKIQNDK
13997-01 1mg $215 cart inquire
Histatin - 3 (H3)
DSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
10370-01 1 mg $400 cart inquire
Histatin - 5
DSHAKRHHGYKRKFHEKHHSHRGY
10355-01 1 mg $188 cart inquire
Histatin - 8 [Hemagglutination] - Inhibiting Peptide
KFHEKHHSHRGY
10356-01 1 mg $230 cart inquire
Human Lactotransferrin (37 - 61), Lactoferricin H
TKCFQWQRNMRKVR - G - PPVSCIKRDS (Disulfide between Cys3 and Cys20)
14266-01 1 mg $226 cart inquire
Human Platelet Factor IV 18, C18G
ALYKKLLKKLLKSAKKLG
14267-01 1 mg $120 cart inquire
Indolicidin
ILPWKWPWWPWRR-CONH2
10353-01 1 mg $138 cart inquire
Innate Defense Regulator-1 (IDR-1)
KSRIVPAIPVSLL
10394-01 1 mg $220 cart inquire
Lactoferricin B Lactoferrin (17 - 41)
FKCRRWQWRMKKLGAPSITCVRRAF (S - S BOND)
14268-01 1 mg $193 cart inquire
LEAP-1, Hepcidin, human
DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridges: 7-23, 10-13, 11-19, 14-22)
10371-001 0.1 mg $210 cart inquire
LEAP - 2 (38 - 77) (Human)
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
10374-01 1 mg $450 cart inquire
LL17 - 29
FKRIVQRIKDFLR
14271-05 5 mg $145 cart inquire
LL17 - 32
FKRIVQRIKDFLRNLV
14272-01 1 mg $120 cart inquire
LL17 - 32 (14272-05)
FKRIVQRIKDFLRNLV
14272-05 5 mg $145 cart inquire
LL-37, Antimicrobial Peptide, human
[LL-37, 37 aa]
10359-01 1 mg $174 cart inquire
LL - 37 fragment (18 - 37), LL - 18 - 37
KRIVQRIKDFLRNLVPRTES
14269-01 1 mg $116 cart inquire
LL-37 pentamide
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
10364-01 1 mg $340 cart inquire
LL-37, reverse sequence
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
10392-005 0.5 mg $138 cart inquire
LL - 37, scrambled
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
14270-01 1 mg $298 cart inquire
Lytic Peptide, SB - 37
MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG
10354-01 1 mg $350 cart inquire
Lytic Peptide, Shiva - 1
MPRLFRRIDRVGKQGILRAGPAIALVGDARAVG
10352-01 1 mg $300 cart inquire
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
10347-01 1 mg $138 cart inquire
Magainin 1 (10347-005)
GIGKFLHSAGKFGKAFVGEIMKS
10347-005 0.5 mg $120 cart inquire
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
10346-01 1 mg $138 cart inquire
Magainin 2-10346-005
GIGKFLHSAKKFGKAFVGEIMNS
10346-005 0.5 mg $120 cart inquire
mCRAMP, mouse
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
10360-01 1 mg $270 cart inquire
Melittin, honey bee
NH2-GIGAVLKVLTTGLPALISWIKRKRQQ-CONH2
10393-01 1 mg $176 cart inquire
Metalnikowin IIA
VDKPDYRPRPWPRPN
10398-01 1 mg $225 cart inquire
Mundticin
KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWSK (Disulfide bridge: 9-14)
10384-005 0.5 mg $500 cart inquire
Mundticin KS
KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWKS (Disulfide bridge: 9-14)
10383-005 0.5 mg $500 cart inquire
OV-1, Sheep
KNLRRIIRKIIHIIKKYG
10365-01 1 mg $245 cart inquire
OV-2, Sheep
LRRIIRKIIHIIKK-CONH2
10366-01 1 mg $220 cart inquire
OV-3, sheep
IRRIIRKIIHIIKK-CONH2
10367-01 1 mg $220 cart inquire
p1025, Acetyl-Adhesin Peptide (1025-1044), amide
Ac-QLKTADLPAGRDETTSFVLV-CONH2
10378-01 1 mg $250 cart inquire
Piscicolin 126
KYYGNGVSCNKNGCTVDWSKAIGIIGNNAAANLTTGGAAGWNKG (Disulfide bridge: 9-14)
10382-005 0.5 mg $470 cart inquire
Plasmodium yoelii Circumsporozoite Protein, PyCSP (280-288)
SYVPSAEQI
10389-01 1 mg $220 cart inquire
Protegrine - 1 (PG - 1), amide
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
14273-01 1 mg $545 cart inquire
Protegrine - 1 (PG - 1), amide-14273-005
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
14273-005 0.5 mg $308 cart inquire
Pyrrhocoricin  N
VDKGSYLPRPTPPRPIYNRN
10397-01 1 mg $116 cart inquire
rCRAMP
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
10361-01 1 mg $340 cart inquire
rCRAMP - 10361-005
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
10361-005 0.5 mg $226 cart inquire
RL-37
RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS
10368-005 0.5 mg $270 cart inquire
Serorphin, BSA (399-404)
YGFQNA
10399-01 1 mg $200 cart inquire
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29
RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
10363-01 1 mg $226 cart inquire
SP2
GFRLTNFGYFEPGK
10369-01 1 mg $220 cart inquire
(T1BT*) - linear
DPNANPNVDPNANPNVNANPNANPNANPEYLNKIQNSLSTEWSPCSVT
13996-01 1mg $364 cart inquire
Temporin A, amide
FLPLIGRVLSGIL - NH2
14274-01 1 mg $120 cart inquire
Temporin L amide
FVQWFSKFLGRIL - NH2
14275-01 1 mg $120 cart inquire
Tetradecapeptide Renin Substrate, Angiotensinogen (1 - 14), rat
DRVYIHPFHLLYYS
14283-01 1 mg $120 cart inquire
Theromacin (49 - 63)
QRLPNNKQCRCINAR (C57-C59 disulfide bridge)
10372-01 1 mg $270 cart inquire
Ubiquitin (65-76), (Ub2)
STLHLVLRLRGG
10395-01 1 mg $225 cart inquire

Biosynthesis Inc.