Cancer Research Peptides, Cancer Research Peptides Products in USA

Chemopreventive peptides are peptides that help prevent the onset or development of a disease such as cancer or diabetes. These peptides can either originate from natural sources, for example from soy or milk, from the design of peptide mimetics, or from peptide screens using synthetic peptides. It is thought that some of these peptides may function as modulators of the cell-cycle that regulates the production and function of proteins needed to advance cells through the replication cycle. In addition, there is now increased evidence that specific dietary pattern, foods and drinks, and other dietary substances can and do protect against cancer. More and more epidemiological studies suggest that food, nutrition and physical activity are important in the prevention and modification of the cancer process. Different types of food proteins and peptides that include plant protease inhibitors, lactoferrin, lactoferricin, lectins and lunasin appear to act as chemopreventive agents. Proteins and peptides are now considered as one group of nutraceuticals that show potential in preventing different stages of cancer including initiation, promotion and progression. Furthermore, some protease inhibitors found in plants such as legumes and soy beans have been found to be effective suppressors of carcinogenesis. Carcinogenesis is the process of initiating and promoting cancer. The Bowman-Birk inhibitor and the Kunitz trypsin inhibitors are among them. Presently the biological function of these compounds in carcinogenesis is mainly attributed to suppress invasion and metastasis of cancer cells, however, the mechanisms of action are still not fully known and further research is needed to fully elucidate them.

Bio-Synthesis offers wide selection of cancer research peptides. If you can’t find what you are looking for, we can provide our custom services. Our cancer research peptides are synthesized under stringent quality control with purity >95%. Large scale can be prepared through our custom synthesis services.

ALL

αβδγ

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

Product Name	Catalog #	Unit	Price/Unit
234 CM - Cancer Research Peptides KYICNSSCM	10582-01	1 mg	$743
234 CW KYMCNSSCM	10583-01	1 mg	$743
[ - 2] pPSA, Prostate - Specific Antigen, truncate SRIVGGWECEK	10559-01	1 mg	$828
[ - 4]pPSA ILSRIVGGWECEK	10561-01	1 mg	$863
[A90,95] Bid BH3 (77 - 100), mouse ESQEEIIHNIARHAAQIGAEMDHN	10701-01	1 mg	$1,047
Adipophilin SVASTITGV	10591-01	1 mg	$743
AH1 Sequence (6 - 14) SPSYVYHQF	14297-01	1 mg	$405
[Ala6, Val15] MUC5AC Analog 2 GTTPSAVPTTSTTSVP	10570-01	1 mg	$777
Amphoterin (150–183) KLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKK	10568-01	1 mg	$1,335
Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY	10681-01	1 mg	$1,283
anti - Flt1 peptide GNQWFI	10581-01	1 mg	$675
[APLILSR]pPSA APLILSRIVGGWECEK	10560-01	1 mg	$878
[Arg67]Bax H2-H3 (53-86), [R67] Helix 2-3 (53-86) DASTKKLSECLKRIRDELDSNMELQRMIAAVDTD	10707-01	1 mg	$1,335
(Asn370) Tyrosinase (368-376) Peptide YMNGTMSQV	10605-01	1 mg	$810
[Asp370] Tyrosinase (368 - 376) Peptide YMDGTMSQV	10596-01	1 mg	$405
Bad (103-127), human, all d-isomers nlwaaqrygrelrrmsdefvdsfkk	10705-01	1 mg	$1,250
BAD BH3 (103-123) NLWAAQRYGRELRRMSDEFVD	10720-01	1 mg	$998
BAD BH3 (146-159) RYGRELRRMSDEFE	10714-01	1 mg	$743
BAD Peptide, biotin-labeled Biotin-LC-AGAGRSRHSSYPAGT	10688-01	1 mg	$845
BAFF-R (160-183) SVPVPATELGSTELVTTKTAGPEQ	10726-01	1 mg	$1,047
BAGE (2 - 10) AARAVFLAL	10630-01	1 mg	$777
Bak - BH3 GQVGRQLAIIGDDINR	10646-01	1 mg	$405
Bak BH3 (67-87) PSSTMGQVGRQLAIIGDDINR	10722-01	1 mg	$998
Bak-BH3 (69-93) STMGQVGRQLAIIGDDINRRYDSEF	10690-01	1 mg	$1,065
Bak BH3 (71-89) MGQVGRQLAIIGDDINRRY	10680-01	1 mg	$828
Bak-BH3 peptide, Mca labeled 7-methoxycoumarine-4-yl acetyl (Mca)-GQVGRQLAIIGDDINR	10668-01	1 mg	$912
Bak-BH3 TAMRA-labeled GQVGRQLAIIGDDINR-K(TAMRA)-CONH2	10473-01	0.1 mg	$783
Bax I PQDASTKKLSECLKRIGDELDSNMEL	10687-01	1 mg	$1,065
Bax - BH3 KKLSECLKRIGDELDS	10647-01	1 mg	$777
Bax BH3 (58-71) KLSECLKRIGDELD	10717-01	1 mg	$743
Bax - BH3L63A KKLSECAKRIGDELDS	10648-01	1 mg	$777
Bax BH3 peptide (55-74), wild type STKKLSECLKRIGDELDSNM	10685-01	1 mg	$845
Bax H2-H3 (53-86), Helix 2-3 DASTKKLSECLKRIGDELDSNMELQRMIAAVDTD	10699-01	1 mg	$1,317
Bax H3 (71-86), Helix 3 (71-86) DSNMELQRMIAAVDTD	10724-01	1 mg	$810
Bcl-2 BH3 (85-105) ALSPVPVVHLTLRQAGDFSRR	10723-01	1 mg	$998
Bcl-2 BH3 Peptide II LSPVPPVVHLALRQAGDDFSRRYRG	10691-01	1 mg	$1,065
Bcl - 2 Binding Peptide Bad BH3 Peptide LWAAQRYGRELRRMSDEFEGSFKGL	14298-01	1 mg	$653
Bcl 9-2 (10692-005) GSEGLSKEQLEHRERSLQTLRDIERLLLRSGETEPFLKGPPGGAG-CONH2	10692-005	0.5 mg	$1,115
Bcl9-2, mutant GSEGLSKEQLEHRERSFQTLRDIERLLLRSGETEPFLKGPPGGAG-CONH2	10693-005	0.5 mg	$1,047
Bcl-XL BH3 (85-98) AVKQALREAGDEFE	10713-01	1 mg	$761
BDC2.5(A) GKKVAAPAWARMG	10643-01	1 mg	$761
BH3 BIM Peptide (52-71), human-10712-01 Ac-MRPEIWIAQELRRIGDEFNA	10712-01	1 mg	$845
Bid - BH3 RNIARHLAQVGDSMDR	10649-01	1 mg	$777
Bid BH3 (77-100), mouse ESQEEIIHNIARHLAQIGDEMDHN	10700-01	1 mg	$1,047
Bid BH3 (79-99) QEDIIRNIARHLAQVGDSMDR	10719-01	1 mg	$998
Bid BH3 (85-98) NIARHLAQVGDSMD	10716-01	1 mg	$743
Bid BH3, FAM labeled 5-FAM-EDIIRNIARHLAQVGDSMDR	10654-01	1 mg	$1,350
Bid BH3 Peptide EDIIRNIARHLAQVGDSMDR	10653-01	1 mg	$392
Bid BH3, Peptide II, TAMRA labeled 5-TAMRA-EDIIRNIARHLAQVGDSMDR	10694-01	1 mg	$1,182
Bid BH3 - r8 rrrrrrrr - GEDIIRNIARHLAQVGDSMDR	14299-005	0.5 mg	$1,209
Bid BH3-R8 RRRRRRRRGEDIIRNIARHLAQVGDSMDR	10671-01	1 mg	$1,148
Bid BH3 - R9 RRRRRRRRRGEDIIRNIARHLAQVGDSMDR	10655-01	1 mg	$1,148
Bik BH3 (50-70) CMEGSDALALRLACIGDEMDV	10721-01	1 mg	$998
Bik BH3 (56-69) ALALRLACIGDEMD	10718-01	1 mg	$743
Bim BH3 (87-100) WIAQELRRIGDEFN	10715-01	1 mg	$743
Bim BH3, Fragment II, TAMRA labeled 5-TAMRA-MRPEIWIAQELRRIGDEFNA	10684-005	0.5 mg	$1,013
Bim BH3 Fragment I, TAMRA labeled 5-TAMRA-DNRPEIWIAQELRRIGDEFNAYYAR	10683-005	0.5 mg	$1,047
Bim BH3, Peptide III DMRPEIWIAQELRRIGDEFNAYYAR	10695-01	1 mg	$653
Bim BH3, Peptide IV DMRPEIWIAQELRRIGDEFNAYYARR	10696-01	1 mg	$669
BMf-BH3 LQHRAEVQIARKLQCIADQFHRLHT	10697-01	1 mg	$1,065
BRCAA1 (610-619) SSKKQKRSHK	10728-01	1 mg	$728
[C92,96] Bid BH3 (77-100), mouse ESQEEIIHNIARHLACIGDCMDHN	10702-01	1 mg	$1,047
Lunasin Peptide NH2-SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD-COOH	14253-001	1 mgs	$1,520
CEA, CAP - 1 - 6 - D, [Asp6] - Carcinoembryonic An YLSGADLNL	10553-01	1 mg	$810
CEA Related, QYSWFVNGTF QYSWFVNGTF	10556-01	1 mg	$710
CEA Related, TYACFVSNL TYACFVSNL	10555-01	1 mg	$810
c - Myc peptide epitope EQKLISEEDL	10544-01	1 mg	$405
Cripto - 1, CR - 1 CPPSFYGRNCEHDVRKE	10551-01	1 mg	$963
[Cys92]Bid BH3 (77-100), mouse ESQEEIIHNIARHLACIGDEMDHN	10703-01	1 mg	$1,047
[Cys96]Bid BH3, mouse ESQEEIIHNIARHLAQIGDCMDHN	10704-01	1 mg	$1,047
[Cys(Acm)33]-Endostatin (6-49) FQPVLHLVALNSPLSGGMRGIRGADFQ-C(Acm)-FQQARAVGLAGTFRAF	10657-005	0.5 mg	$1,133
E75, Her - 2/neu (369 - 377) KIFGSLAFL	10594-01	1 mg	$743
EGFR (662-681) RRELVEPLTPSGEAPNQALLR	10667-01	1 mg	$998
Enhanced Green Fluorescent Protein, EGFP (200 - 208) HYLSTQSAL	14300-01	1 mg	$405
Ep - CAM (263 - 271) GLKAGVIAV	10558-01	1 mg	$743
G154, gp100 (154-162) KTWGQYWQV	10562-01	1 mg	$878
G209-2M, gp100 (209-217) IMDQVPFSV	10564-01	1 mg	$405
G209, gp100 (209-217) ITDQVPFSV	10563-01	1 mg	$810
G280-9, gp100 (280-288), Lys (biotin) YLEPGPVTA-K(Biotin)	10566-01	1 mg	$810
G280-9V, gp100(280-288) Lys(biotin) YLEPGPVTV-K(Biotin)	10565-01	1 mg	$810
GAD65 (78–97) KPCNCPKGDVNYAFLHATDL	10641-01	1 mg	$912
[Gln340]-Maspin, Reactive Site Loop (RSL), (330-34 GGDSIEVPGAQILQHK	10729-01	1 mg	$777
GnT - V (nt38 - 67) VLPDVFIRCV	10607-01	1 mg	$777
gp100 (177–186) AMLGTHTMEV	10633-01	1 mg	$828
gp100 (178 - 187) MLGTHTMEV	10617-01	1 mg	$777
gp100 (25–33), human KVPRNQDWL	10730-01	1 mg	$405
gp100 (457 - 466) LLDGTATLRL	10604-01	1 mg	$728
gp100 (476 - 485) VLYRYGSFSV	10616-01	1 mg	$777
gp100 (570–579) SLADTNSLAV	10615-01	1 mg	$777
gp100 (614–622) LIYRRRLMK	10612-01	1 mg	$710
gp100 (619–627) RLMKQDFSV	10614-01	1 mg	$710
gp100 (639–647) RLPRIFCSC	10613-01	1 mg	$777
GPC3 (144 - 152) FVGEFFTDV	10602-01	1 mg	$743
GPC3 (298 - 306), mouse EYILSLEEL	10603-01	1 mg	$777
GRP78 Binding Chimeric Peptide Motif (10679-01) WIFPWIQL-GG- klaklakklaklak-CONH2	10679-01	1 mg	$1,047
HB-1 (26-41) EDDVYLRHSSSLTYRL	10725-01	1 mg	$777
HER - 2/Neu (654 - 662), GP2 IISAVVGIL	10557-01	1 mg	$743
HIF - 1 {alpha} (556 - 574) DLDLEMLAPYIPMDDDFQL	10644-01	1 mg	$413
HIF - 2 (66 - 84) SLEAQGIKADRETVAVKPT	10645-01	1 mg	$828
Human PD - L1 inhibitor I NEW	14301-01	1 mg	$507
Human PD - L1 inhibitor II NEW	14302-01	1 mg	$507
Human PD - L1 inhibitor III NEW	14303-01	1 mg	$507
Human PD - L1 inhibitor IV NEW	14304-01	1 mg	$626
Human PD - L1 inhibitor V NEW	14305-01	1 mg	$405
IL-11R-alpha Binding Peptide II CGRRAGGSC (S-S bonded)	10678-01	1 mg	$845
[Ile12, Val15] MUC5AC Analog 3 GTTPSPVPTTSITSVP	10571-01	1 mg	$777
[Ile161]MAGE-A2 (157-166) YLQLIFGIEV	10632-01	1 mg	$828
iLRP1, iLRP, Immature Laminin Receptor Protein (58-66) LLLAARAIV	13696-01	1 mg	$390
iLRP2, iLRP (60 - 68) LAARAIVAI	10651-01	1 mg	$710
iLRP3, iLRP(146 - 154 ) ALCNTDSPL	13697-01	1 mg	$473
iLRP4, iLRP(7-15) VLQMKEEDV	13700-01	1 mg	$375
IP3 peptide, Acetylated and Biotinylated Ac-MPRFMDYWEGLNK-K(Biotin)	10590-01	1 mg	$912
IP3 peptide, (Lys)TAMRA labeled MPRFMDYWEGLN-K(5/6-TMR)	10589-01	1 mg	$1,115
IP3 Truncated Peptide, Acetylated Ac-FMDYWEGLN	10588-01	1 mg	$710
Kisspeptin - 10 (Kp - 10) Metastin (110 - 119), amide, mouse, rat YNWNSFGLRY - NH2	14306-01	1 mg	$405
Kisspeptin - 10 (Kp - 10) Metastin (45 - 54) YNWNSFGLRF	14307-01	1 mg	$405
KM - HN - 1(107 - 116) VFGTRIEKDL	10636-01	1 mg	$743
KM - HN - 1(196 - 204) NYNNFYRFL	10634-01	1 mg	$710
KM - HN - 1(335 - 343) HFCRKCKKL	10637-01	1 mg	$828
KM - HN - 1(499 - 508) EYSKECLKEF	10638-01	1 mg	$828
KM - HN - 1(65 - 74) SFQALRMQTL	10635-01	1 mg	$761
KM - HN - 1(770 - 778) EYLSLSDKI	10639-01	1 mg	$743
Laminin Peptide CDPGYIGSR-amide	13694-01	1 mg	$375
Livin7, ML - IAP KWFPSCQFLL	10595-01	1 mg	$810
LyP-1, Peptide 2 CGNKRTRGC	10677-01	1 mg	$392
MAGE - 1 (161 - 169) EADPTGHSY	10606-01	1 mg	$777
MAGE - 1 (230–238 ) STAPPAHGV	10578-01	1 mg	$743
MAGE3 (112 - 120) KVAELVHFL	10620-01	1 mg	$743
MAGE-3 (161-169) EVDPIGHLY	10576-01	1 mg	$743
MAGE - 3 (271 - 279) FLWGPRALV	10577-01	1 mg	$405
MAGE - A1 (237 - 245) KLLTQDLVQ	10618-01	1 mg	$743
MAGE-A 1(96–104) SLFRAVITK	10733-01	1 mg	$710
MAGE-A1 Antigen (278-286); human KVLEYVIKV	10709-01	1 mg	$710
MAGE - A2 (112 - 120) KMVELVHFL	10619-01	1 mg	$743
MAGE - A2 (157 - 166) YLQLVFGIEV	10631-01	1 mg	$810
MAGE - A3 (167 - 176) MEVDPIGHLY	10627-01	1 mg	$810
MAGE - A3 (195 - 203) IMPKAGLLI	10628-01	1 mg	$710
MAGE-A4 Antigen (230-239), human GVYDGREHTV	10708-01	1 mg	$728
MAGE - C2 (336–344) ALKDVEERV	10597-01	1 mg	$743
Melan - A/MART - 1 (24 - 34) AEEAAGIGILT	10611-01	1 mg	$777
Melanosomal Antigen II DAEKCDKTDEY	10626-01	1 mg	$828
MUC1 mucin core GVTSAPDTRPAPGSTA	10548-01	1 mg	$431
MUC1, tandem repeat fragment PDTRPAPGSTAPPAHGVTSA	10593-01	1 mg	$392
MUC5AC, Analog 1 GTTPSPVPTTSTTSAP	10569-01	1 mg	$405
MUC5AC, Analog B TTSTTSAPTTS	10575-01	1 mg	$710
MUM - 1 (261 - 269) EEKLIVVLF	10580-01	1 mg	$743
MycC Peptide YEQLRNSRA	10545-01	1 mg	$693
MZ2 - F YRPRPRRY	10608-01	1 mg	$710
NES Adenoviral E1A VMLAVQEGIDL	10660-01	1 mg	$777
NES Nmd3p (491-500) INIDELLDEL	10662-01	1 mg	$710
NES p120ctn CSLEEELDVLVLDDEGG	10658-01	1 mg	$795
NES Topoisomerase II alpha (1054-1066) FILEKIDGKIIIE	10664-01	1 mg	$728
Nuclear Factor (Erythroid - derived 2)like 2 (74 - 87); Nrf2 (74 - 87); NFE2L2 (74 - 87) LQLDEETGEFLPIQ	14312-01	1 mg	$930
Noxa A BH3 peptide cell permeable rrrrrrrrGAELPPEFAAQLRKIGDKVYC	14311-01	1 mg	$1,007
Noxa BH3, Peptide 1-10698-01 PAELEVECATQLRRFGDKLNFRQKLL	10698-01	1 mg	$1,065
NuBCP-9 A FSRSLHSLL	10706-01	1 mg	$710
Nuclear Export Signal, NES HIV Rev LQLPPLERLTLD	10663-01	1 mg	$710
Nuclear Export Signal, NES MAPKK ALQKKLEELELD	10661-01	1 mg	$710
Nuclear Export Signal, NES p53 FRELNEALELKD	10659-01	1 mg	$710
ORF5 fragment PASKKTDPQK	10601-01	1 mg	$743
p53 (12 - 20) PPLSQETFS	10585-01	1 mg	$743
p53, (12 - 26) PPLSQETFSDLWKLL	10584-01	1 mg	$795
p53 (17 - 26) ETFSDLWKLL	10586-01	1 mg	$405
p53 (17-26) FITC labeled FITC-LC-ETFSDLWKLL-CONH2	10710-01	1 mg	$743
p53 Mutant Form (361-371), Pab 421 KKGQSTSRHKK-CONH2	10676-01	1 mg	$693
p53 Tumor Suppressor (361-393), human GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD	10727-01	1 mg	$1,283
PRAME epitope (PRA300 - 309) Tumor - associated an ALYVDSLFFL	10547-01	1 mg	$896
Prostate - Specific Antigen, PSA propeptide APLILSR	10549-01	1 mg	$845
Pro - TGF - α HADLLAVVAASQ	10546-01	1 mg	$1,080
PSA1(141 - 150) FLTPKKLQCV	10598-01	1 mg	$810
PSA2 (146–154) KLQCVDLHV	10599-01	1 mg	$743
Rab24 (179 - 199) QVMTEDKGVDLSQKANPYFYS	10554-01	1 mg	$998
RAGE derived peptide SPSSNRIRNT	10600-01	1 mg	$777
Shepherdin (79 - 87) KHSSGCAFL	14313-01	1 mg	$405
Stromal Target Antigen SIYYYRYGL	10567-01	1 mg	$777
Survivin ELTLGEFLKL	10592-01	1 mg	$743
Survivin 2B (80–88) AYACNTSTL	10732-01	1 mg	$743
Telomerase Reverse Transcriptase p572Y (TERT572Y) RLFFYRKSV	10711-01	1 mg	$710
Thrombospondin - derived Peptide Cyclic CSVTCG CSVTCG (S - S Bonded)	14314-01	1 mg	$405
TP53 Q9NP68, p53 Mutant Form (361-377), Lys371 (Ac KKGQSTSRHK-K(Ac)-LMFKTEG	10675-01	1 mg	$810
TRP - 1, Fragment MSLQRQFL	10610-01	1 mg	$710
TRP - 2, Tyrosinase - related Protein 2 (181 - 188) VYDFFVWL	14316-01	1 mg	$405
TRP - 2 (180 - 188) SVYDFFVWL	14315-01	1 mg	$405
TRP - 2 coding region fragment LLPGGRPYR	10609-01	1 mg	$710
Tyrosinase (146 - 156) SSDYVIPIGTY	10621-01	1 mg	$777
Tyrosinase (192 - 200) SEIWRDIDF	10623-01	1 mg	$743
Tyrosinase (206 - 214), T9206 AFLPWHRLF	10622-01	1 mg	$743
Tyrosinase (240 - 251) DAEKCDICTDEY	10640-01	1 mg	$878
Tyrosinase (240-251) DAEKSDICTDEY	10734-01	1 mg	$810
Tyrosinase(243 - 251),core nonamer sequence KCDICTDEY	10629-01	1 mg	$828
Tyrosinase (450 - 462) SYLQDSDPDSFQD	10625-01	1 mg	$878
Tyrosinase (56–70) QNILLSNAPLGPQFP	10624-01	1 mg	$828
VEGFR2/KDR Antagonist ATWLPPR	10550-01	1 mg	$413
VEGFR-2/KDR II, murine VILTNPISM	10673-01	1 mg	$743
VEGFR-2/KDR I, murine FSNSTNDILI	10672-01	1 mg	$743

Oligonucleotide Services

DNA Synthesis

RNA Synthesis

Large Scale Oligo Synthesis

Long Oligo Synthesis

QPCR Probes And Primers

Peptide Nucleic Acid (PNA)

Bridged Nucleic Acid (BNA)

Peptide Services

Peptide Modifications

Peptide Labeling

Specialty Peptide Synthesis

Additional Services

Immunochemistry Services

Antibody Modifications

Conjugation Services by Type

Oligo Conjugation Services

Antibody Conjugation Services

Additional Conjugation Services

Services Selected by Name

Services Selected by Application

Molecular Biology Products

Additional Services

Bioanalytical ​Services

Educational Resources

Scientific Tools

Online Quotes

Online Orders

Printable Forms

MSDS / SDS Sheets

Additional Resources

Cancer Research Peptides Products

Bioanalytical Services