Services

Targeting & Delivery Peptides

Custom synthesis of peptide sequences designed for cellular uptake, tissue targeting, receptor recognition, membrane insertion, organelle localization, blood–brain barrier transport, and endosomal escape.

Cell-Penetrating Peptides Tumor-Homing Peptides BBB Shuttle Peptides pHLIP Organelle Targeting Endosomal Escape

Select the Peptide Around the Biological Route

Targeting and delivery peptides are selected according to the biological barrier or destination that must be addressed. Some sequences promote nonspecific cellular uptake, while others recognize a receptor, home to tumor-associated tissue, insert into membranes at low pH, cross biological barriers, or help a payload escape from endosomes.

These peptides can be synthesized alone or incorporated into multifunctional constructs containing fluorescent dyes, affinity tags, lipids, PEG spacers, cleavable linkers, oligonucleotides, proteins, nanoparticles, or small-molecule payloads.

Design principle: peptide sequence alone does not determine delivery performance. Cargo size, attachment site, linker architecture, peptide orientation, charge, hydrophobicity, formulation, and assay model can all influence biological behavior.

Targeting and delivery peptide pathways from extracellular recognition to intracellular destination A multifunctional peptide cargo construct moves through receptor targeting, membrane transport, endosomal escape, and organelle delivery pathways. TARGETING & DELIVERY PATHWAYS Sequence selection follows the biological barrier, destination, and cargo. Tissue Targeting RGD · NGR · BBB shuttles Receptor recognition or tissue homing Peptide–Cargo Construct Targeting peptide + linker + payload Cellular Uptake TAT · Penetratin · R8/R9 Direct translocation or endocytosis CELL MEMBRANE Endosome escape Cytosol Organelle Receptor Targeting Membrane Transport Endosomal Escape Organelle Delivery
The same peptide may support more than one step, but targeting, uptake, endosomal escape, and intracellular trafficking should be evaluated as separate design requirements.

Explore Targeting and Delivery Peptide Classes

Select a family to view representative peptides and sequences. Catalog-page links can be added later to each peptide name or arrow.

Cell-Penetrating Peptides

Cationic, amphipathic, or membrane-interacting sequences used to promote cellular uptake of peptides and conjugated cargos.

HIV-1 TAT

CPP
YGRKKRRQRRR

Function: Cationic cellular uptake


Typical use: Peptide, protein, ASO, and siRNA delivery

Penetratin

CPP
RQIKIWFQNRRMKWKK

Function: Membrane translocation


Typical use: Intracellular delivery and imaging

Transportan

CPP
GWTLNSAGYLLGKINLKALAALAKKIL

Function: Amphipathic cellular uptake


Typical use: Cargo and nucleic-acid delivery

Poly-Arginine R8

CPP
RRRRRRRR

Function: Cationic uptake


Typical use: Cellular delivery and uptake studies

Tumor-Homing Peptides

Peptides selected to recognize tumor-associated receptors, vasculature, extracellular matrix, or tissue microenvironments.

RGD Motif

Tumor Homing
RGD

Function: Integrin recognition


Typical use: Targeted imaging and delivery

iRGD

Tumor Penetration
CRGDKGPDC

Function: Integrin binding and tissue penetration


Typical use: Tumor-directed payload delivery

NGR

Tumor Vasculature
CNGRC

Function: CD13-associated targeting


Typical use: Tumor vascular targeting

CREKA

Matrix Targeting
CREKA

Function: Fibrin-associated homing


Typical use: Tumor imaging and nanoparticle delivery

Blood–Brain Barrier Peptides

Receptor-binding or shuttle peptides investigated for transport across the blood–brain barrier and CNS delivery.

Angiopep-2

BBB Shuttle
TFFYGGSRGKRNNFKTEEY

Function: LRP1-associated transport


Typical use: CNS delivery and imaging

ApoE-Derived Peptide

BBB / Lipoprotein
LRKLRKRLL

Function: Receptor-interacting motif


Typical use: CNS cargo delivery studies

RVG-Derived Peptide

Neuronal Targeting
YTIWMPENPRPGTPCDIFTNSRGKRASNG

Function: Nicotinic receptor-associated targeting


Typical use: Neuronal and CNS delivery

pHLIP Peptides

pH-responsive membrane-inserting peptides used to target acidic tissues and transport attached cargos across lipid bilayers.

Wild-Type pHLIP

pH-Responsive
AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT

Function: Low-pH membrane insertion


Typical use: Acidic tissue targeting and translocation

pHLIP Variant

pH-Responsive
Sequence varies by design

Function: Tuned insertion and kinetics


Typical use: Tumor targeting and cargo delivery

Nuclear Localization Peptides

Basic sequence motifs recognized by nuclear transport machinery and used to promote nuclear accumulation of conjugated cargos.

SV40 NLS

NLS
PKKKRKV

Function: Nuclear import signal


Typical use: DNA, protein, and gene-editing cargo delivery

Nucleoplasmin NLS

Bipartite NLS
KRPAATKKAGQAKKKK

Function: Nuclear localization


Typical use: Nuclear delivery studies

Mitochondrial Targeting Peptides

Amphipathic, cationic, or aromatic-cationic sequences used to direct peptides and payloads toward mitochondria.

SS-31 / Elamipretide

Mitochondrial
D-Arg-Dmt-Lys-Phe-NH2

Function: Mitochondrial membrane association


Typical use: Oxidative-stress and mitochondrial studies

Mitochondrial Targeting Motif

MTS
MLSLRQSIRFFKPATRTLCSSRYLL

Function: Mitochondrial import signal


Typical use: Organelle targeting constructs

Endosomal Escape Peptides

Fusogenic or pH-responsive peptides designed to destabilize endosomal membranes and improve cytosolic release.

HA2

Fusogenic
GLFGAIAGFIENGWEGMIDGWYG

Function: pH-triggered membrane disruption


Typical use: Endosomal escape and cytosolic delivery

INF7

Fusogenic
GLFEAIEGFIENGWEGMIDGWYG

Function: HA2-derived endosomal disruption


Typical use: RNA and macromolecule delivery

GALA

pH-Responsive
WEAALAEALAEALAEHLAEALAEALEALAA

Function: Acid-triggered amphipathic helix


Typical use: Gene and nucleic-acid delivery

Membrane-Active Peptides

Amphipathic peptides used to interact with, perturb, or permeabilize lipid membranes in controlled delivery systems.

KALA

Membrane Active
WEAKLAKALAKALAKHLAKALAKALKACEA

Function: Membrane destabilization


Typical use: Intracellular and nucleic-acid delivery

Melittin

Membrane Active
GIGAVLKVLTTGLPALISWIKRKRQQ

Function: Membrane permeabilization


Typical use: Mechanistic and delivery research

MPG

CPP / Fusogenic
GALFLGFLGAAGSTMGAWSQPKKKRKV

Function: Cell entry and cargo transport


Typical use: Oligonucleotide and macromolecule delivery

Common Targeting and Delivery Peptides

This reference table provides representative sequences and functions. Sequence variants, terminal modifications, stereochemistry, cyclization, and conjugation handles can be customized. If you cannot find the peptide or sequence you need, contact our peptide team for assistance or browse our Catalog Peptide Library for additional peptide families and sequences.

Search peptide or sequence
Select target
Select application
0 peptides
Peptide Family Representative Sequence Primary Function Typical Use
HIV-1 TAT Cell-Penetrating Peptides YGRKKRRQRRR Cationic cellular uptake Peptide, protein, ASO, and siRNA delivery
Penetratin Cell-Penetrating Peptides RQIKIWFQNRRMKWKK Membrane translocation Intracellular delivery and imaging
Transportan Cell-Penetrating Peptides GWTLNSAGYLLGKINLKALAALAKKIL Amphipathic cellular uptake Cargo and nucleic-acid delivery
Poly-Arginine R8 Cell-Penetrating Peptides RRRRRRRR Cationic uptake Cellular delivery and uptake studies
RGD Motif Tumor-Homing Peptides RGD Integrin recognition Targeted imaging and delivery
iRGD Tumor-Homing Peptides CRGDKGPDC Integrin binding and tissue penetration Tumor-directed payload delivery
NGR Tumor-Homing Peptides CNGRC CD13-associated targeting Tumor vascular targeting
CREKA Tumor-Homing Peptides CREKA Fibrin-associated homing Tumor imaging and nanoparticle delivery
Angiopep-2 Blood–Brain Barrier Peptides TFFYGGSRGKRNNFKTEEY LRP1-associated transport CNS delivery and imaging
ApoE-Derived Peptide Blood–Brain Barrier Peptides LRKLRKRLL Receptor-interacting motif CNS cargo delivery studies
RVG-Derived Peptide Blood–Brain Barrier Peptides YTIWMPENPRPGTPCDIFTNSRGKRASNG Nicotinic receptor-associated targeting Neuronal and CNS delivery
Wild-Type pHLIP pHLIP Peptides AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT Low-pH membrane insertion Acidic tissue targeting and translocation
pHLIP Variant pHLIP Peptides Sequence varies by design Tuned insertion and kinetics Tumor targeting and cargo delivery
SV40 NLS Nuclear Localization Peptides PKKKRKV Nuclear import signal DNA, protein, and gene-editing cargo delivery
Nucleoplasmin NLS Nuclear Localization Peptides KRPAATKKAGQAKKKK Nuclear localization Nuclear delivery studies
SS-31 / Elamipretide Mitochondrial Targeting Peptides D-Arg-Dmt-Lys-Phe-NH2 Mitochondrial membrane association Oxidative-stress and mitochondrial studies
Mitochondrial Targeting Motif Mitochondrial Targeting Peptides MLSLRQSIRFFKPATRTLCSSRYLL Mitochondrial import signal Organelle targeting constructs
HA2 Endosomal Escape Peptides GLFGAIAGFIENGWEGMIDGWYG pH-triggered membrane disruption Endosomal escape and cytosolic delivery
INF7 Endosomal Escape Peptides GLFEAIEGFIENGWEGMIDGWYG HA2-derived endosomal disruption RNA and macromolecule delivery
GALA Endosomal Escape Peptides WEAALAEALAEALAEHLAEALAEALEALAA Acid-triggered amphipathic helix Gene and nucleic-acid delivery
KALA Membrane-Active Peptides WEAKLAKALAKALAKHLAKALAKALKACEA Membrane destabilization Intracellular and nucleic-acid delivery
Melittin Membrane-Active Peptides GIGAVLKVLTTGLPALISWIKRKRQQ Membrane permeabilization Mechanistic and delivery research
MPG Membrane-Active Peptides GALFLGFLGAAGSTMGAWSQPKKKRKV Cell entry and cargo transport Oligonucleotide and macromolecule delivery

Sequence note: sequences are shown in the standard N-to-C direction unless otherwise stated. D-amino acids, amidation, cyclization, lipidation, PEG spacing, or other modifications should be explicitly defined during quoting.

Build the Construct Around Cargo and Biological Destination

Targeting and delivery function can change after conjugation. These factors should be reviewed before synthesis.

Cargo Size & Charge

Small molecules, peptides, proteins, ASOs, siRNA, and nanoparticles impose different steric and electrostatic constraints.

Attachment Site

N-terminal, C-terminal, lysine, cysteine, and unnatural-amino-acid handles can affect orientation and activity.

Spacer Architecture

Ahx, PEG, amino-acid spacers, and cleavable linkers can improve accessibility or enable release.

Sequence Format

Linear, cyclic, stapled, D-amino-acid, retro-inverso, and lipidated formats may change stability and uptake.

Solubility & Aggregation

Highly cationic or hydrophobic sequences may require formulation, counterion, or purification optimization.

Biological Model

Performance can differ across purified systems, cultured cells, organoids, and in vivo models.

Endosomal Release

Cell entry does not guarantee cytosolic delivery; an escape motif or cleavable design may be required.

Analytical Strategy

Mass confirmation, analytical HPLC, identity testing, and project-specific characterization should match complexity.

Need Help Selecting a Targeting or Delivery Peptide?

Share the intended biological destination, cargo type, preferred attachment site, sequence requirements, scale, purity, and downstream assay. Our scientists can review sequence feasibility, linker architecture, conjugation route, purification risk, and analytical requirements before manufacturing begins.

Helpful Project Information

  • Peptide sequence or target peptide family
  • Biological destination or receptor
  • Cargo type and molecular size
  • Preferred conjugation site and linker
  • Other labels, lipids, or modifications
  • Required quantity, purity, and formulation
  • Relevant publication or catalog reference

How We Evaluate Your Design

We review sequence complexity, charge, hydrophobicity, attachment-site accessibility, linker length, orthogonal chemistry, purification feasibility, and project-specific QC. When a requested route is impractical, we explain the limitation and propose a scientifically sound alternative.

Targeting & Delivery Peptide FAQ

FAQ

Can you synthesize D-amino-acid or retro-inverso variants?
Yes. D-amino-acid substitution, retro-inverso designs, terminal modifications, and other stability-enhancing formats can be evaluated.
Are the sequences on this page fixed?
No. They are representative starting points. Sequence truncation, substitution, cyclization, lipidation, spacer addition, and conjugation-site engineering can be customized.
Can a targeting peptide be combined with an endosomal escape peptide?
Yes. Multifunctional constructs can combine receptor targeting, cellular uptake, and endosomal escape, provided the architecture is designed to preserve each function.
How should the peptide be attached to the cargo?
The preferred site depends on the peptide mechanism and active region. N-terminal, C-terminal, lysine, cysteine, or unnatural-amino-acid handles can be used with direct, PEG, or cleavable linkers.
Can you make cyclic RGD and other constrained targeting peptides?
Yes. Disulfide-cyclized, head-to-tail, side-chain-cyclized, stapled, and other constrained architectures can be evaluated.
What QC is recommended?
Mass confirmation and analytical HPLC are standard starting points. Additional testing can be selected according to sequence complexity, cargo, intended use, and formulation.
What is the difference between a targeting peptide and a delivery peptide?
A targeting peptide recognizes a biological destination such as a receptor, tissue, or cell type. A delivery peptide promotes uptake, membrane interaction, intracellular transport, or cargo release. Some sequences perform both functions.
Can these peptides be conjugated to oligonucleotides or proteins?
Yes. They can be linked to ASOs, siRNA, proteins, dyes, drugs, lipids, nanoparticles, and other cargos using site-specific conjugation handles and linker systems.

Recommended Reading

Selected foundational and review articles covering cell-penetrating peptides, tumor-homing peptides, pH-responsive membrane insertion, blood–brain barrier shuttles, and intracellular delivery design.

  1. Guidotti G, Brambilla L, Rossi D. Cell-penetrating peptides: from basic research to clinics. Trends in Pharmacological Sciences. 2017;38:406–424.
  2. Sugahara KN, Teesalu T, Karmali PP, et al. Tissue-penetrating delivery of compounds and nanoparticles into tumors. Cancer Cell. 2009;16:510–520.
  3. Reshetnyak YK, Andreev OA, Lehnert U, Engelman DM. Translocation of molecules into cells by pH-dependent insertion of a transmembrane helix. Proceedings of the National Academy of Sciences USA. 2006;103:6460–6465.
  4. Demeule M, Régina A, Ché C, et al. Identification and design of peptides as a new drug delivery system for the brain. Journal of Pharmacology and Experimental Therapeutics. 2008;324:1064–1072.
  5. Wadia JS, Stan RV, Dowdy SF. Transducible TAT–HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis. Nature Medicine. 2004;10:310–315.
  6. Bio-Synthesis technical resource. Catalog Peptide Library for additional targeting, signaling, transport, and biologically active peptide sequences.

Scientific note: A published sequence is a starting point rather than a guarantee of equivalent performance after conjugation. Cargo identity, attachment site, linker architecture, formulation, and assay model can alter targeting, uptake, trafficking, and release.

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45 years of delivering high-quality, fast, and scalable synthetic biology solutions.