Live Chat Support Software
800.227.0627

Definition

Follicular dendritic cell-secreted protein (FDC-SP) is expressed by activated follicular dendritic cells from human tonsils and FDC-like cell lines activated by TNF-alpha and specifically binds to activated B cells1.             

 

Related Peptides

FDC-SP is expressed specifically in periodontal ligament and parotid gland, and has molecular properties similar to those of statherin, a protein in saliva thought to function in preventing calcium precipitation. Both molecules are small in size (68 and 43 residues for mature human FDC-SP and statherin, respectively) and have a proline-rich region in their C-terminal half. In addition, these regions show high degree of hydrophobicity in contrast to their N-terminal hydrophilic regions. Such structural similarities strongly suggested that additional roles for FDC-SP exist and that additional experiments looking for functional similarities between FDC-SP and statherin would be very informative2.

 

Discovery

Marshall et al reported the discovery of the FDC gene encoding the FDC-secreted protein in 20021.

 

Structural Characteristics

Human and mouse FDC- secreted proteins are structurally unique, containing a conserved N-terminal charged region adjacent to the leader peptide. FDC-SP undergoes heterogeneous post-translational modification during biosynthesis and trafficking through the secretory pathway. The pairs of basic residues flanking the proline-rich sequence of FDC-SP might be important for its function, as such dibasic motifs are known to be potential target sites for cleavage by proteases1,3.

 

Mode of Action

FDC-SP functions in intercellular communication by binding target cells through a specific signaling receptor, analogous to cytokines/chemokines. While FDC-SP does not share significant primary sequence homology with cytokines or chemokines, the overall amino acid composition, molecular mass, and charge (pI) of FDC-SP is similar to known inflammatory mediators such as IL-8. Furthermore, FDC-SP is linked to the cluster of alpha-chemokines on chromosome 4q13 that includes IL-8 and other proinflammatory chemokines1.

 

Functions

FDC-SP can induce chemotaxis of CD40 stimulated non-transgenic B-cells and can significantly enhance B-cell migration in combination with chemokines, indicating that FDC-SP may function in part by regulating B-cell chemotaxis. FDC-SP may function by binding to and influencing the behavior of immune cells. FDC-SP regulates GC (germinal centre) initiation and maintenance by acting upon newly activated B cells transiting from the T zones. To our knowledge, FDC-SP is the first FDC-restricted gene product that binds to activated but not resting B cells1,3. FDC-SP may play an important role, adsorbing onto the surface of cementum and alveolar bone adjacent to periodontal ligament and onto tooth surface at the gingival crevice2.

References

 

1.     Aaron J. Marshall, Quijiang Du, Kevin E. Draves, Yasufumi Shikishima, Kent T (2002). HayGlass, and Edward A. Clark. 2002. FDC-SP, a Novel Secreted Protein Expressed by Follicular Dendritic Cells. J Immunol., 169, 2381-2389.

2.     Shinomura T, Nakamura S, Ito K, Shirasawa S, Höök M and Kimura JH (2008). Adsorption of follicular dendritic cell-secreted protein (FDC-SP) onto mineral deposits. Application of a new stable gene expression system. J Biol. Chem., 283 (48), 33658-64.

3.     Al-Alwan M, Du Q, Hou S, Nashed B, Fan Y, Yang X and Marshall AJ (2007).  Follicular Dendritic Cell Secreted Protein (FDC-SP) Regulates Germinal Center and Antibody Responses. J Immunol., 178, 7859 -7867.

ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
FDC - SP (30 - 85), human
SISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
11024-01 1 mg $450 cart inquire
FDC - SP (61 - 85), human
FPWFRRNFPIPIPESAPTTPLPSEK
11025-01 1 mg $315 cart inquire

Biosynthesis Inc.