Live Chat Support Software
800.227.0627


ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
[Arg(Me1)17] - Histone H3 (1 - 21) - GGK(Biotin) H3R17(Me1) biotin - labeled
ARTKQTARKSTGGKAP - R(Me1) - KQLA - GGK(Biotin) - NH2
14644-01 1 mg $380 cart inquire
[Arg(Me1)3] - Histone H4(1 - 21) - GGK(Biotin) H4R3(Me1) biotin - labeled
Ac - SG - R(Me1) - GKGGKGLGKGGAKRHRKVGG - K(Biotin)
14734-01 1 mg $345 cart inquire
[Arg(Me1)3] - Histone H4 (1 - 23) - GGK(Biotin)
SG - R(Me1) - GKGGKGLGKGGAKRHRKVLRGG - K(Biotin)
14711-01 1 mg $380 cart inquire
[Arg(Me1)8] - Histone H3 (1 - 21) - K(Biotin) H3R8(Me1) biotin labeled
ARTKQTA - R(Me1) - KSTGGKAPRKQLA - K(Biotin) - NH2
14617-01 1 mg $380 cart inquire
[Arg(Me2a)26] - Histone H3 (15 - 36) - GGK(Biotin) H3R26(Me2a) biotin labeled
APRKQLATKAA - R(Me2a) - KSAPATGGVKGG - K(Biotin)
14661-01 1 mg $345 cart inquire
[Arg(Me2a)3] - Histone H4(1 - 21) - GGK(Biotin) H4R3(Me2a) biotin - labeled
Ac - SG - R(Me2a) - GKGGKGLGKGGAKRHRKVGG - K(Biotin)
14735-01 1 mg $345 cart inquire
[Arg(Me2a)3] - Histone H4 (1 - 23) - GGK(Biotin)
SG - R(Me2a) - GKGGKGLGKGGAKRHRKVLRGG - K(Biotin)
14721-01 1 mg $345 cart inquire
[Arg(Me2a)8] - Histone H3(1 - 21) - K(Biotin) H3R8(Me2a) biotin - labeled
ARTKQTA - R(Me2a) - KSTGGKAPRKQLA - K(Biotin) - NH2
14618-01 1 mg $380 cart inquire
[Arg(Me2s)26] - Histone H3 (15 - 36) - GGK(Biotin)H3R26(Me2s) biotin labeled
APRKQLATKAA-R(me2s)-KSAPATGGVKGG-K(biotin)
14662-01 1 mg $345 cart inquire
[Arg(Me2s)3] - Histone H4 (1 - 21) - GGK(Biotin) H4R3(Me2s) (1 - 21) biotin - labeled
Ac - SG - R(me2s) - GKGGKGLGKGGAKRHRKV - GGK(biotin)
14736-01 1 mg $725 cart inquire
[Arg(Me2s)3] - Histone H4 (1 - 23) - GGK(Biotin)
SG - R(Me2s) - GKGGKGLGKGGAKRHRKVLRGG - K(Biotin)
14712-01 1 mg $380 cart inquire
[Arg(Me2s)8] - Histone H3 (1 - 21) biotin - labeled
ARTKQTA - R(Me2s) - KSTGGKAPRKQLA - K(Biotin)
14619-01 1 mg $345 cart inquire
[Cit17] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTARKSTGGKAP - Cit - KQLAGG - K(Biotin)
14645-01 1 mg $330 cart inquire
[Cit26] - Histone H3 (21 - 44) - GGK(Biotin)
ATKAA - Cit - KSAPATGGVKKPHRYRPGGG - K(Biotin)
14678-01 1 mg $330 cart inquire
[Cit 2/8/17] - Histone H3 (1 - 21) - GGK(Biotin) amide
A - Cit - TKQTA - Cit - KSTGGKAP - Cit - KQLAGG - K(Biotin) - NH2
14603-025 0.25 mg $245 cart inquire
[Cit3] - Histone H4 (1 - 23) - GGK(Biotin)
SG - Cit - GKGGKGLGKGGAKRHRKVLRGG - K(Biotin)
14710-01 1 mg $380 cart inquire
[Lys(Ac)12] - Histone H4 (1 - 20) H4K12(Ac)
SGRGKGGKGLG - K(Ac) - GGAKRHRK
14730-01 1 mg $176 cart inquire
[Lys(Ac)12] - Histone H4 (1 - 21) - GGK(Biotin) H4K12(Ac)biotin - labeled
Ac - SGRGKGGKGLG - K(Ac) - GGAKRHRKVGG - K(Biotin)
14704-01 1 mg $264 cart inquire
[Lys(Ac)12] - Histone H4 (1 - 25) - GSGSK(Biotin) H4K12(Ac) biotin - labeled
SGRGKGGKGLG - K(Ac) - GGAKRHRKVLRDNGSGS - K(Biotin)
14714-01 1 mg $330 cart inquire
[Lys(Ac)12/16] - Histone H4(1 - 25) - GSGSK(Biotin)H4K12/16(Ac) biotin - labeled
SGRGKGGKGLG - K(Ac) - GGA - K(Ac) - RHRKVLRDNGSGS - K(Biotin)
14720-01 1 mg $345 cart inquire
[Lys(Ac)12/16, Lys(Me3)20] - Histone H4 (1 - 25) - GSGSK(Biotin)
SGRGKGGKGLG - K(Ac) - GGA - K(Ac) - RHR - K(Me3) - VLRDNGSGS - K(Biotin)
14722-01 1 mg $345 cart inquire
[Lys(Ac)14] - Histone H3 (1 - 19) H3K14(Ac)
ARTKQTARKSTGG - K(Ac) - APRKQ
14599-01 1 mg $176 cart inquire
[Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin)H3K14(Ac) biotin - labeled
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)
14642-025 0.25 mg $120 cart inquire
[Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin)H3K14(Ac) biotin - labeled
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)
14643-01 1 mg $242 cart inquire
[Lys(Ac)14] - Histone H3 (9 - 19)H3K14(Ac)
KSTGG - K(Ac) - APRKQ
14659-01 1 mg $120 cart inquire
[Lys(Ac)14/18/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AGG - K(Biotin)
14650-01 1 mg $380 cart inquire
[Lys(Ac)14/18/23/27] - Histone H3 (1 - 30) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AAR - K(Ac) - SAPGG - K(Biotin)
14652-01 1 mg $380 cart inquire
[Lys(Ac)16] - Histone H4 (1 - 20) H4K16(Ac)
SGRGKGGKGLGKGGA - K(Ac) - RHRK
14731-01 1 mg $176 cart inquire
[Lys(Ac)16] - Histone H4 (1 - 21) - GGK(Biotin)H4K16(Ac), biotin - labeled
Ac - SGRGKGGKGLGKGGA - K(Ac) - RHRKVGG - K(Biotin)
14701-01 1 mg $264 cart inquire
[Lys(Ac)16] - Histone H4 (1 - 25) - GSGSK(Biotin)H4K16(Ac)biotin - labeled
SGRGKGGKGLGKGGA - K(Ac) - RHRKVLRDNGSGS - K(Biotin)
14715-01 1 mg $330 cart inquire
[Lys(Ac)18] - Histone 3 (1 - 21) - GGK(Biotin) H3K18(Ac) biotin - labeled
ARTKQTARKSTGGKAPR - K(Ac) - QLA - GGK(Biotin) - NH2
14646-01 1 mg $330 cart inquire
[Lys(Ac)20] - Histone H4 (1 - 25) - GSGSK(Biotin) H4K20(Ac) biotin - labeled
SGRGKGGKGLGKGGAKRHR - K(Ac) - VLRDNGSGS - K(Biotin)
14716-01 1 mg $330 cart inquire
[Lys(Ac)23] - Histone H3 (21 - 44) - GK(Biotin) H3K23(Ac) biotin - labeled
AT - K(Ac) - AARKSAPATGGVKKPHRYRPGG - K(Biotin)
14679-01 1 mg $330 cart inquire
[Lys(Ac)27] - Histone 3 (21 - 44) - GK(Biotin) H3K27(Ac) biotin - labeled
ATKAAR - K(Ac) - SAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
14671-01 1 mg $330 cart inquire
[Lys(Ac)27] - Histone H3 (21 - 43) - GGK(Biotin) H3K27(Ac) biotin - labeled
ATKAAR - K(Ac) - SAPATGGVKKPHRYRPGG - K(Biotin)
14673-01 1 mg $264 cart inquire
[Lys(Ac)27] - Histone H3 (23 - 34) H3K27(Ac)
KAAR - K(Ac) - SAPATGG
14683-01 1 mg $120 cart inquire
[Lys(Ac)36] - Histone H3 (21 - 44) - GK(Biotin) H3K36(Ac) biotin - labeled
ATKAARKSAPATGGV - K(Ac) - KPHRYRPGG - K(Biotin)
14676-01 1 mg $330 cart inquire
[Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
ART - K(Ac) - QTARKSTGGKAPRKQLAGG - K(biotin)
14604-01 1 mg $330 cart inquire
[Lys(Ac)5] - Histone H4 (1 - 20) H4K5(Ac)
SGRG - K(Ac) - GGKGLGKGGAKRHRK
14728-01 1 mg $176 cart inquire
[Lys(Ac)5] - Histone H4 (1 - 21) - GGK(Biotin) H4K5(Ac) biotin - labeled
Ac - SGRG - K(Ac) - GGKGLGKGGAKRHRKVGG - K(Biotin)
14700-01 1 mg $264 cart inquire
[Lys(Ac)5] - Histone H4 (1 - 25) - GSGSK(Biotin) H4K5(Ac) biotin - labeled
SGRG - K(Ac) - GGKGLGKGGAKRHRKVLRDNGSGS - K(Biotin)
14717-01 1 mg $380 cart inquire
[Lys(Ac)56] - Histone H3 (44 - 63)
GTVALREIRRYQ - K(Ac) - STELLIR
14691-01 1 mg $205 cart inquire
[Lys(Ac)5/8/12/16] - Histone H4 (1 - 21) - GGK(Biotin) H4K5/8/12/16(Ac)biotin - labeled
SGRG - K(Ac) - GG - K(Ac) - GLG - K(Ac) - GGA - K(Ac) - RHRKVGG - K(Biotin)
14706-01 1 mg $380 cart inquire
[Lys(Ac)5/8/12/16] - Histone H4 (1 - 25) - GSGSK
SGRG - K(Ac) - GG - K(Ac) - GLG - K(Ac) - GGA - K(Ac) - RHRKVLRDNGSGSK
14723-01 1 mg $390 cart inquire
[Lys(Ac) 5/8/12/16] - Histone H4 (1 - 25) - GSGSK(Biotin)
SGRG - K(Ac) - GG - K(Ac) - GLG - K(Ac) - GGA - K(Ac) - RHRKVLRDNGSGS - K(Biotin)
14713-01 1 mg $380 cart inquire
[Lys(Ac)79] - Histone H3 (69 - 89) H3K79(Ac) biotin - labeled
RLVREIAQDF - K(Ac) - TDLRFQSSAV - K(biotin)
14593-01 1 mg $320 cart inquire
[Lys(Ac)8] - Histone H4 (1 - 20) H4K8(Ac)
SGRGKGG - K(Ac) - GLGKGGAKRHRK
14729-01 1 mg $176 cart inquire
[Lys(Ac)8] - Histone H4 (1 - 21) - GGK(Biotin) H4K8(Ac) biotin - labeled
Ac - SGRGKGG - K(Ac) - GLGKGGAKRHRKV - GGK(Biotin)
14702-01 1 mg $264 cart inquire
[Lys(Ac)8] - Histone H4 (1 - 25) - GSGSK(Biotin) H4K8(Ac) biotin - labeled
SGRGKGG - K(Ac) - GLGKGGAKRHRKVLRDNGSGS - K(Biotin)
14718-01 1 mg $380 cart inquire
[Lys(Ac)9] - Histone H3 (1 - 20) H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQL
14601-01 1 mg $176 cart inquire
[Lys(Ac)9] - Histone H3 (1 - 21) GGK(Biotin) H3K9(Ac) biotin - labeled
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin)
14623-01 1 mg $242 cart inquire
[Lys(Ac)9] - Histone H3 (1 - 21) - GGK(Biotin) H3K9(Ac) biotin - labeled
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin)
14622-025 0.25 mg $120 cart inquire
[Lys(Ac)9] - Histone H3 (1 - 21) H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQLA
14620-01 1 mg $198 cart inquire
[Lys(Ac)9] - Histone H3 (1 - 21) - NH2 H3K9(Ac) biotin - labeled amide
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin) - NH2
14621-01 1 mg $226 cart inquire
[Lys(Ac)9] - Histone H3 (1 - 24) H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQLATKA
14649-01 1 mg $176 cart inquire
[Lys(Ac)9/14] - Histone H3 (1 - 21) - GGK(Biotin) H3K9/14(Ac) biotin - labeled
ARTKQTAR - K(Ac) - STGG - K(Ac) - APRKQLA - GGK(Biotin)
14624-025 0.25 mg $120 cart inquire
[Lys(Ac)9/14] - Histone H3 (1 - 21) - GGK(Biotin) H3K9/14(Ac) biotin - labeled
ARTKQTAR - K(Ac) - STGG - K(Ac) - APRKQLA - GGK(Biotin)
14625-01 1 mg $248 cart inquire
[Lys(Me1)12] - Histone H4(1 - 21) - GGK(Biotin)H4K12(Me1) biotin - labeled
Ac - SGRGKGGKGLG - K(Me1) - GGAKRHRKVGG - K(Biotin)
14708-01 1 mg $380 cart inquire
[Lys(Me1)18] - Histone H3 (1 - 21) - GGK(Biotin) H3K18(Me1) biotin - labeled
ARTKQTARKSTGGKAPR - K(Me1) - QLA - GGK(Biotin) - NH2
14647-01 1 mg $330 cart inquire
[Lys(Me1)20] - Histone H4 (1 - 23) - GGK(Biotin) H4K20(Me1) biotin - labeled
SGRGKGGKGLGKGGAKRHR - K(Me1) - VLR - GGK(Biotin) - NH2
14697-01 1 mg $330 cart inquire
[Lys(Me1)20] - Histone H4 (8 - 30) - WGK(Biotin) H4K20(Me1) (8 - 30) biotin - labeled
14725-01 1 mg $330 cart inquire
[Lys(Me1)23] - Histone H3 (21 - 44) - GK(Biotin)H3K23(Me1) biotin - labeled
AT - K(Me1) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
14672-01 1 mg $330 cart inquire
[Lys(Me1)27/36] - Histone H3 (21 - 44) - GK(Biotin) H3K27(Me1)K36(Me1)
ATKAAR - K(Me1) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin
14594-01 1 mg $396 cart inquire
[Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin) H3K36(Me1) biotin - labeled
ATKAARKSAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
14680-025 0.25 mg $120 cart inquire
[Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin) H3K36(Me1) biotin - labeled
ATKAARKSAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
14681-01 1 mg $330 cart inquire
[Lys(Me1)36] - Histone H3 (26 - 46) - K(Biotin) H3K36(Me1) Schizosaccharomyces octosporus
RKAAPATGGV - K(Me1) - KPHRYRPGTV - K(BIOTIN)
14687-01 1 mg $330 cart inquire
[Lys(Me1)36] - Histone H3 (31 - 41) H3K36(Me1)
STGGV - K(Me1) - KPHRY
14689-01 1 mg $171 cart inquire
[Lys(Me1)4] - Histone H3 (1 - 10) H3K4(Me1)
ART - K(Me1) - QTARKS
14596-01 1 mg $171 cart inquire
[Lys(Me1)4] - Histone H3 (1 - 21) - GGK(Biotin) H3K4(Me1) biotin - labeled
ART - K(Me1) - QTARKSTGGKAPRKQLA - GGK(Biotin)
14610-025 0.25 mg $120 cart inquire
[Lys(Me1)4] - Histone H3 (1 - 21) - GGK(Biotin) H3K4(Me1) biotin - labeled
ART - K(Me1) - QTARKSTGGKAPRKQLA - GGK(Biotin)
14611-01 1 mg $308 cart inquire
[Lys(Me1)4] - Histone H3 (1 - 21)H3K4(Me1)
ART - K(Me1) - QTARKSTGGKAPRKQLA
14605-01 1 mg $292 cart inquire
[Lys(Me1)79] - Histone H3 (69 - 89) - K(Biotin) H3K79(Me1) biotin labeled
RLVREIAQDF - K(Me1) - TDLRFQSSAV - K(Biotin)
14695-025 0.25 mg $122 cart inquire
[Lys(Me1)9] - Histone H3 (1 - 21) biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin)
14626-01 1 mg $300 cart inquire
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin) H3K9(Me1) biotin - labeled amide
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin) - NH2
14629-01 1 mg $330 cart inquire
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin) H3K9(Me1) biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin)
14627-025 0.25 mg $120 cart inquire
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin) H3K9(Me1) biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin)
14628-01 1 mg $308 cart inquire
[Lys(Me1)9] - Histone H3 (1 - 21) H3K9(Me1)
ARTKQTAR - K(Me1) - STGGKAPRKQLA
14696-01 1 mg $205 cart inquire
[Lys(Me1)9] - Histone H3 (3 - 17) H3K9(Me1)
TKQTAR - K(Me1) - STGGKAPR
14655-01 1 mg $171 cart inquire
[Lys(Me2)18] - Histone H3 (1 - 21) - GGK(Biotin) H3K18(Me2) biotin - labeled
ARTKQTARKSTGGKAPR - K(Me2) - QLA - GGK(Biotin) - NH2
14648-01 1 mg $330 cart inquire
[Lys(Me2)20] - Histone H4 (1 - 23) - GGK(Biotin) H4K20(Me2)biotin - labeled
SGRGKGGKGLGKGGAKRHR - K(Me2) - VLR - GGK(Biotin) - NH2
14699-01 1 mg $330 cart inquire
[Lys(Me2)20] - Histone H4 (8 - 30) - WGK(Biotin)H4K20(Me2) (8 - 30) biotin - labeled
14726-01 1 mg $330 cart inquire
[Lys(Me2)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin) H3K27(Me2)K36(Me1) biotin - labeled
ATKAAR - K(Me2) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
14595-01 1 mg $185 cart inquire
[Lys(Me2)27] - Histone H3 (21 - 44) - GK(Biotin)H3K27(Me2) biotin - labeled
ATKAAR - K(Me2) - SAPATGGVKKPHRYRPG - GK(Biotin)
14674-025 0.25 mg $120 cart inquire
[Lys(Me2)27] - Histone H3 (21 - 44) - GK(Biotin) H3K27(Me2)biotin - labeled
ATKAAR - K(Me2) - SAPATGGVKKPHRYRPG - GK(Biotin)
14675-01 1 mg $298 cart inquire
[Lys(Me2)27] - Histone H3 (23 - 34) H3K27(Me2)
KAAR - K(Me2) - SAPATGG
14684-01 1 mg $171 cart inquire
[Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin) H3K36(Me2) biotin - labeled
ATKAARKSAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
14663-025 0.25 mg $120 cart inquire
[Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin) H3K36(Me2) biotin - labeled
ATKAARKSAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
14664-01 1 mg $330 cart inquire
[Lys(Me2)36] - Histone H3 (26 - 46) H3K36(Me2)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)
14688-01 1 mg $330 cart inquire
[Lys(Me2)36] - Histone H3 (31 - 41) H3K36(Me2)
STGGV - K(Me2) - KPHRY
14690-01 1 mg $171 cart inquire
[Lys(Me2)4] - Histone H3 (1 - 10) H3K4(Me2)
ART - K(Me2) - QTARKS
14597-01 1 mg $171 cart inquire
[Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin) H3K4(Me2) biotin - labeled
ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin)
14612-025 0.25 mg $120 cart inquire
[Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin) H3K4(Me2) biotin - labeled
ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin)
14613-01 1 mg $281 cart inquire
[Lys(Me2)4] - Histone H3 (1 - 21) H3K4(Me2)
ART - K(Me2) - QTARKSTGGKAPRKQLA
14606-01 1 mg $220 cart inquire
[Lys(Me2)79] - Histone H3 (69 - 89) - K(Biotin) H3K79(Me2) biotin - labeled
RLVREIAQDF - K(Me2) - TDLRFQSSAV - K(Biotin)
14694-025 0.25 mg $122 cart inquire
[Lys(Me2)9] - Histone H3 (1 - 21)
ARTKQTAR - K(Me2) - STGGKAPRKQLA
14630-01 1 mg $205 cart inquire
[Lys(Me2)9] Histone H3 (1 - 21) - GGK(Biotin) H3K9(Me2) biotin - labeled
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin)
14632-025 0.25 mg $120 cart inquire
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin) H3K9(Me2) biotin - labeled amide
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin) - NH2
14634-01 1 mg $330 cart inquire
[Lys(Me2)9] Histone H3 (1 - 21) - K(Biotin) H3K9(Me2) biotin labeled
ARTKQTAR - K(Me2) - STGGKAPRKQLA - K(Biotin)
14631-01 1 mg $237 cart inquire
[Lys(Me2)9] - Histone H3 (3 - 17) H3K9(Me2)
TKQTAR - K(Me2) - STGGKAPR
14656-01 1 mg $171 cart inquire
[Lys(Me3)12] - Histone H4(1 - 21) - GGK(Biotin) H4K12(Me3) biotin - labeled
Ac - SGRGKGGKGLG - K(Me3) - GGAKRHRKVGG - K(Biotin)
14709-01 1 mg $380 cart inquire
[Lys(Me3)20] - Histone H4 (1 - 23) - GGK(Biotin) H4K20(Me3) biotin - labeled
SGRGKGGKGLGKGGAKRHR - K(Me3) - VLR - GGK(Biotin) - NH2
14698-01 1 mg $330 cart inquire
[Lys(Me3)20] - Histone H4 (8 - 30) - WGK(Biotin) H4K20(Me3) (8 - 30)biotin - labeled
14727-01 1 mg $330 cart inquire
[Lys(Me3)27] - Histone H3 (23 - 34) H3K27(Me3)
KAAR - K(Me3) - SAPATGG
14685-01 1 mg $171 cart inquire
[Lys(Me3)27 - Histone H3 (23 - 34) - GGK(Biotin)
KAAR - K(Me3) - SAPATGGGG - K(Biotin)
14686-01 1 mg $205 cart inquire
[Lys(Me3)36] - Histone H3 (21 - 44) - GK(Biotin) H3K36(Me3) biotin - labeled
ATKAARKSAPATGGV - K(Me3) - KPHRYRPG - GK(Biotin)
14665-025 0.25 mg $120 cart inquire
[Lys(Me3)36] - Histone H3 (21 - 44) - GK(Biotin) H3K36(Me3) biotin - labeled
ATKAARKSAPATGGV - K(Me3) - KPHRYRPG - GK(Biotin)
14666-01 1 mg $330 cart inquire
[Lys(Me3)4] - Histone H3 (1 - 10) H3K4(Me3)
ART - K(Me3) - QTARKS
14598-01 1 mg $171 cart inquire
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin) H3K4(Me3) biotin - labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin)
14614-025 0.25 mg $120 cart inquire
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin) H3K4(Me3) biotin labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
14609-01 1 mg $314 cart inquire
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin) H3K4(Me3) biotin - labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin)
14615-01 1 mg $308 cart inquire
[Lys(Me3)4] - Histone H3 (1 - 21) H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLA
14607-025 0.25 mg $120 cart inquire
[Lys(Me3)4] - Histone H3 (1 - 21) H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLA
14608-01 1 mg $292 cart inquire
[Lys(Me3)4] - Histone H3 (1 - 25) H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLATKAA - NH2
14651-01 1 mg $308 cart inquire
[Lys (Me3)4 Lys (Ac)9 pSer10] - Histone H3 (1 - 21)
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA
14616-01 1 mg $380 cart inquire
[Lys(Me3)79] - Histone H3(73 - 83) H3K79(Me3)
EIAQDF - K(Me3) - TDLR
14592-01 1 mg $120 cart inquire
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin) H3K9(Me3) biotin - labeled
ARTKQTAR - K(Me3) - STGGKAPRKQLA - GGK(Biotin)
14636-025 0.25 mg $120 cart inquire
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin) H3K9(Me3) biotin - labeled
ARTKQTAR - K(Me3) - STGGKAPRKQLA - GGK(Biotin)
14637-01 1 mg $308 cart inquire
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin) H3K9(Me3)biotin - labeled amide
ARTKQTAR - K(Me3) - STGGKAPRKQLAGG - K(Biotin) - NH2
14638-01 1 mg $330 cart inquire
[Lys(Me3)9] - Histone H3 (1 - 21) H3K9(Me3)
ARTKQTAR - K(Me3) - STGGKAPRKQLA
14635-01 1 mg $220 cart inquire
[Lys(Me3)9] - Histone H3 (3 - 17) H3K9(Me3)
TKQTAR - K(Me3) - STGGKAPR
14657-01 1 mg $171 cart inquire
[pSer10] - Histone H3 (1 - 21) - GGK(Biotin) H3pS10 biotin - labeled
ARTKQTARK - pS - TGGKAPRKQLA - GGK(Biotin) - NH2
14639-01 1 mg $380 cart inquire
[pSer10) Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin) biotin - labeled
ARTKQTARK - pS - TGG - K(Ac) - APRKQLAGGK(Biotin)
14640-025 0.25 mg $120 cart inquire
[pSer28] - Histone H3 (21 - 44) - GK (Biotin)biotin - labeled
ATKAARK - pS - APATGGVKKPHRYRPGG - K(Biotin)
14677-01 1 mg $300 cart inquire
[pThr11] - Histone H3(1 - 21) - GGK(Biotin)H3pT11 biotin - labeled
ARTKQTARKS - pT - GGKAPRKQLAGG - K(Biotin) - NH2
14641-01 1 mg $320 cart inquire
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA] Biotinylated
Biotin-ARKRERTYSFGHHA
13069-01 1 mg $138 cart inquire
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA] Biotinylated
Biotin-ARKRERTYSFGHHA
13069-05 5 mg $567 cart inquire
[Arg(Me1)26] - Histone H3 (15 - 36) - K(Biotin), H3R26(Me1), biotin labeled
NH2-APRKQLATKAA-R(Me1)-KSAPATGGVK-K(Biotin)-CONH2
14013-01 1 mg $485 cart inquire
[Arg(Me1)8] - Histone H3 (1 - 21) - K(Biotin), H3R8(Me1), biotin labeled
ARTKQTA-R(Me1)-KSTGGKAPRKQLA-K(Biotin)-CONH2
14141-01 1.0 mg $485 cart inquire
[Arg(Me2a)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a), biotin - labeled
ARTKQTARKSTGGKAP-R(Me2a)-KQLA-GGK(Biotin)-CONH2
14014-01 1 mg $485 cart inquire
[Arg(Me2s)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2s), biotin - labeled
ARTKQTARKSTGGKAP-R(Me2s)-KQLA-GGK(Biotin)-CONH2
14140-01 1.0 mg $485 cart inquire
[Arg(Me2s)2] - Histone H3 (1 - 21) - GGK(Biotin); H3R2(Me2s), biotin - labeled
A-R(Me2s)-TKQTARKSTGGKAPRKQLA-GGK(Biotin)-CONH2
14053-005 0.5 mg $290 cart inquire
[Arg(Me2s)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A-R(Me2s)-T-K(Me2)-QTARKSTGGKAPRKQLAGG-K(Biotin)
14052-005 0.5 mg $310 cart inquire
[Arg(Me2s)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A-R(Me2s)-T-K(Me3)-QTARKSTGGKAPRKQLAGG-K(Biotin)
14162-005 0.5 mg $300 cart inquire
CDK5 Substrate [PKTPKKAKKL]
PKTPKKAKKL
12330-01 1 mg $120 cart inquire
FITC - LC - TAT (47 - 57)
FITC - LC - YGRKKRRQRRR - NH2
14369-005 0.5 mg $149 cart inquire
Histone 4 (1-20) PRMT7 Substrate M1
SGRGKGGKGLGKGGAKRHRK-CONH2
13448-01 1 mg $116 cart inquire
Histone deacetylase HDAC substrate
Ac - RGK(Ac) - AMC
14737-01 1 mg $138 cart inquire
Histone H1 derived peptide
GGGPATPKKAKKL
13285-01 1 mg $120 cart inquire
Histone H1 - derived peptide FAM - labeled
5-FAM-GGGPATPKKAKKL-OH
13286-01 1 mg $226 cart inquire
Histone H2A (1 - 20)
SGRGKQGGKARAKAKTRSSR
14586-01 1 mg $116 cart inquire
Histone H2A (1 - 20) - GGK(Biotin) biotin - labeled
SGRGKQGGKARAKAKTRSSRGG - K(Biotin)
14587-01 1 mg $264 cart inquire
Histone H2A (1 - 22) - GK(Biotin)
SGRGKQGGKARAKAKSRSSRAG - GK(Biotin) - NH2
14588-01 1 mg $330 cart inquire
Histone H2B (21 - 41), biotin labeled
AQKKDGKKRKRSRKESYSIYVGG - K(Biotin)
14589-01 1 mg $237 cart inquire
Histone H3 (1 - 20) N - Terminal
ARTKQTARKSTGGKAPRKQL
14600-01 1 mg $116 cart inquire
Histone H3 (1 - 21) Biotinylated
ARTKQTARKSTGGKAPRKQLA-GG-K(BIOTIN)-CONH2
13243-01 1 mg $220 cart inquire
Histone H3 (1 - 21), FAM labeled
ARTKQTARKSTGGKAPRKQLAGG - K(FAM) - NH2
14602-01 1 mg $308 cart inquire
Histone H3 (1 - 21) N - Terminal
ARTKQTARKSTGGKAPRKQLA
13242-01 1 mg $171 cart inquire
Histone H3 (1 - 25)amide
ARTKQTARKSTGGKAPRKQLATKAA-CONH2
13244-01 1 mg $193 cart inquire
Histone H3(1 - 35)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
14653-025 0.25 mg $345 cart inquire
Histone H3 (1 - 50) - GGK(Biotin) biotin - labeled
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG - K(Biotin)
14654-025 0.25 mg $575 cart inquire
Histone H3 (15 - 36) - GGK(Biotin)
APRKQLATKAARKSAPATGGVKGG-K(biotin)
14660-01 1 mg $330 cart inquire
Histone H3 (1 - 8)
ARTKQTAR
14590-01 1 mg $120 cart inquire
Histone H3 (21 - 44)
ATKAARKSAPATGGVKKPHRYRPG
14667-01 1 mg $188 cart inquire
Histone H3 (21 - 44) - GK(Biotin)biotin - labeled
ATKAARKSAPATGGVKKPHRYRPG - GK(Biotin)
14668-025 0.25 mg $120 cart inquire
Histone H3 (21 - 44) - GK(Biotin) biotin - labeled amide
ATKAARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
14670-01 1 mg $330 cart inquire
Histone H3 (21 - 44) - GK(Biotin) biotin - labeled
ATKAARKSAPATGGVKKPHRYRPG - GK(Biotin)
14669-01 1 mg $330 cart inquire
Histone H3 (23 - 34)
KAARKSAPATGG
14682-01 1 mg $120 cart inquire
Histone H3 (5 - 23)
QTARKSTGGKAPRKQLASK
14658-01 1 mg $100 cart inquire
Histone H3 (69 - 89) H3K79 amide
RLVREIAQDFKTDLRFQSSAV-NH2
14692-01 1 mg $171 cart inquire
Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDFKTDLRFQSSAV - K(Biotin)
14693-01 1 mg $220 cart inquire
Histone H3 (73 - 83)
EIAQDFKTDLR
14591-01 1 mg $120 cart inquire
Histone H4 (1 - 21) - Lys(Biotin)
Ac - SGRGKGGKGLGKGGAKRHRKVGG - K(Biotin)
14732-01 1 mg $232 cart inquire
Histone H4 (1 - 21) p300/CBP Substrate
SGRGKGGKGLGKGGAKRHRKV
14733-01 1 mg $171 cart inquire
Histone H4 (1 - 23) - GGK(Biotin) biotin labeled amide
SGRGKGGKGLGKGGAKRHRKVLRGG - K(Biotin) - NH2
14707-01 1 mg $226 cart inquire
Histone H4 (1 - 23) - GSGSK C - terminal biotin - labeled
SGRGKGGKGLGKGGAKRHRKVLRGSGS - K(Biotin)
14703-01 1 mg $237 cart inquire
Histone H4 (1 - 25) - GSGSK(Biotin)
SGRGKGGKGLGKGGAKRHRKVLRDNGSGS - K(Biotin)
14719-01 1 mg $320 cart inquire
Histone H4 (1 - 7) N - Terminal
SGRGKGG
13351-01 1 mg $120 cart inquire
Histone H4 (8 - 25) - WC amide
KGLGKGGAKRHRKVLRDNWC - NH2
14705-01 1 mg $120 cart inquire
K(biotin) - W - Histone H2B (108 - 125); H2B, C - Terminal biotin - labeled
K(biotin)-WKHAVSEGTKAVTKYTSSK
14106-005 0.5 mg $260 cart inquire
[Lys(Ac)11] - Histone H2B (1 - 21) - GGK(Biotin), H2BK11(Ac), biotin - labeled
PEPSKSAPAP-K(Ac)-KGSKKAITKAGG-K(Biotin)
14159-005 0.5 mg $280 cart inquire
[Lys(Ac)13] - Histone H2A (1 - 22) - GK(Biotin) - NH2; H2AK13(Ac), biotin - labeled
SGRGKQGGKARA-K(Ac)-AKSRSSRAGG-K(Biotin)-CONH2
14158-005 0.5 mg $265 cart inquire
[Lys(Ac)15] - Histone H2B (1 - 21) - WGK(Biotin)
PEPSKSAPAPKKGS-K(Ac)-KAITKAWG-K(Biotin)
14102-01 1 mg $395 cart inquire
[Lys(Ac)23] - Histone H3 (21 - 44)
AT-K(Ac)-AARKSAPSTGGVKKPHRYRPG
14051-005 0.5 mg $250 cart inquire
[Lys(Ac)5] - Histone H2A (1 - 20) - GGK(Biotin), H2AK5(Ac), biotin - labeled
SGRG-K(Ac)-QGGKARAKAKTRSSRGG-K(Biotin)
14143-01 1.0 mg $369 cart inquire
[Lys(Ac)5] - Histone H2B (1 - 22) - GGK(Biotin) - NH2; H2BK5(Ac), biotin - labeled
PEPA-K(Ac)-SAPAPKKGSKKAVTKAQ-GGK(Biotin)-CONH2
14104-005 0.5 mg $270 cart inquire
[Lys(Ac)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Ac), biotin - labeled
ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)
14142-005 0.5 mg $260 cart inquire
[Lys(Me1)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me1), biotin - labeled
ARTKQTARKSTGGKAPR-K(Me1)-QLA-GGK(Biotin)-CONH2
14164-005 0.5 mg $265 cart inquire
[Lys(Me1)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1), biotin - labeled
ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)
14137-005 0.5 mg $260 cart inquire
[Lys(Me1)27] - Histone H3 (21 - 44) - GK(Biotin) H3K27(Me1) biotin - labeled
ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)
14137-01 1 mg $330 cart inquire
[Lys(Me1)27] - Histone H3 (21 - 44) - GK(Biotin) H3K27(Me1) biotin - labeled
ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)
14137-0.25 0.25 mg $120 cart inquire
[Lys(Me1)27] - Histone H3 (23 - 34) H3K27(Me1)
KAAR-K(Me1)-SAPATGG
14105-01 1 mg $271 cart inquire
[Lys(Me1)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me1), biotin - labeled
ART-K(Me1)-QTARKSTGGKAPRKQLA-GGK(Biotin)
14054-01 1 mg $413 cart inquire
[Lys(Me1)79] - Histone H3 (58 - 89)
TELLIRKLPFQRLVREIAQDF-K(Me1)-TDLRFQSAAI
14139-005 0.5 mg $280 cart inquire
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me1), biotin - labeled
ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)
14161-005 0.5 mg $265 cart inquire
[Lys(Me2)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me2), biotin - labeled
ARTKQTARKSTGG-K(Me2)-APRKQLAGG-K(Biotin)-CONH2
14160-005 0.5 mg $300 cart inquire
[Lys(Me2)23] - Histone H3 (21 - 44) - GK(Biotin), H3K23(Me2), biotin - labeled
AT-K(Me2)-AARKSAPSTGGVKKPHRYRPGG-K(Biotin)-CONH2
14136-005 0.5 mg $260 cart inquire
[Lys(Me2)5] - Histone H2B (1 - 22) - GGK(Biotin), H2BK5(Me2), biotin - labeled
PEPA-K(Me2)-SAPAPKKGSKKAVTKAQGG-K(Biotin)-CONH2
14163-01 1 mg $435 cart inquire
[Lys(Me3)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3), biotin - labeled
ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)
14138-005 0.5 mg $260 cart inquire
[Lys(Me3)27] - Histone H3 (21 - 44) - GK(Biotin) H3K27(Me3) biotin - labeled
ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)
14138-0.25 0.25 mg $120 cart inquire
[Lys(Me3)27] - Histone H3 (21 - 44) - GK(Biotin) H3K27(Me3) biotin - labeled
ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)
14138-01 1 mg $330 cart inquire
[Lys(Me3)36] - Histone H3 (31 - 41) H3K36(Me3)
STGGV-K(Me3)-KPHRY
14101-01 1 mg $171 cart inquire
[Lys(Me3)5] - Histone H2B (1 - 22) - GGK(Biotin), H2BK5(Me3), biotin - labeled
PEPA-K(Me3)-SAPAPKKGSKKAVTKAQGG-K(Biotin)-CONH2
14103-01 1 mg $435 cart inquire
[Lys(Me3)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me3), biotin labeled
RLVREIAQDF-K(Me3)-TDLRFQSSAV-K(biotin)
14135-005 0.5 mg $280 cart inquire
[Lys(Me3)79] - Histone H3 (69 - 89) - K(Biotin) H3K79(Me3) biotin labeled
RLVREIAQDF-K(Me3)-TDLRFQSSAV-K(biotin)
14135-025 0.25 mg $222 cart inquire

Biosynthesis Inc.