Live Chat Support Software
800.227.0627


ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
BDC2.5 Mimotope
RTRPLWVRME
14816-01 1 mg $120 cart inquire
IGRP Catalytic Subunit - related Protein (206 - 214)
VYLKTNVFL
14817-01 1 mg $120 cart inquire
Insulin B (9 - 23)
SHLVEALYLVCGERG
13241-01 1 mg $120 cart inquire
Insulin β Chain Peptide (15 - 23)
LYLVCGERG
14818-01 1 mg $120 cart inquire
Pancreatic Polypeptide human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-CONH2
12811-01 1 mg $210 cart inquire
Pancreatic Polypeptide human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY - NH2
12811-005 0.5 mg $116 cart inquire

Biosynthesis Inc.