Live Chat Support Software
800.227.0627


ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
[Ser(OGlcNAc)]400 - KWK-Tau (388 - 411) - KK(Biotin) - NH2
KWKHGAEIVYKSPVV - S(OGlcNAc) - GDTSPRHLSNVK - K(biotin) - NH2
14871-01 1 mg $375 cart inquire
Tau Peptide (244 - 274) (Repeat 1 domain)
Ac - QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
14867-01 1 mg $120 cart inquire
Tau Peptide (275 - 305) (Repeat 2 domain)
VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS
14868-01 1 mg $120 cart inquire
Tau Peptide (306 - 336) (Repeat 3 domain)
VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
14869-01 1 mg $120 cart inquire
Tau Peptide (337 - 368) (Repeat 4 domain)
VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
14870-01 1 mg $120 cart inquire
Tau Peptide (45 - 73) (Exon 2/Insert 1 domain)
ESPLQTPTEDGSEEPGSETSDAKSTPTAE
14866-01 1 mg $120 cart inquire

Biosynthesis Inc.