⌘ Services

Our Capabilities

Company

About Us
Mission
History
Facility
Career
News

Since 1984

Trusted Partner

40+ years of excellence in custom synthesis and bioconjugation services.

Learn More →

Products & Services

Oligonucleotides

Peptides

Molecular Biology

Bioconjugation

Immuno Chemistry

Bioanalytical Services

Oligonucleotide Services ›
Custom Oligo Synthesis ›
Oligo Modification ›
Oligo Bioconjugation ›
Speciality Oligonucleotide Synthesis ›
Analytical & QC Services ›
Development Services ›
Formulation & Product Development ›

Custom Peptide Type ›
Custom Peptide Synthesis ›
Peptide Modifications ›
Specialized Peptide Technologies ›
Catalog Peptides ›
Peptide Bioconjugation ›
Peptide Purification & Analytics ›

Molecular Biology Services ›

Bioconjugation Service ›
Biomolecule Conjugates ›

Immuno Services ›
Antibody Engineering & Conjugation ›

Bioanalytical Services ›

OligoTech at BSI
Oligo Services at BSI
OligoLS RUO
OligoDX Diagnostic
OligoTX Therapeutic

Analytical & QC Services at BSI
Oligo Release QC Services
Oligo Process Development

Analytical Method Development
Oligo Stability Study

Custom Oligos at BSI
Custom DNA Synthesis
HT DNA Plate Oligos
Long DNA Synthesis
Custom RNA Synthesis
HT RNA Plate Oligos
Long RNA Synthesis
Custom siRNA Synthesis
Large-Scale Oligonucleotide ›
Purification Services

Modification by Types ›
Modification by Properties ›
Modification by Applications ›
Modification by Name

Large-Scale Oligonucleotide
Large-Scale DNA Synthesis
Large-Scale RNA Synthesis

Modification by Type at BSI
Hapten‑Tagged/Affinity Ligand
Backbone Modifications
Chelators
Conjugation Modifications
Cross‑Linking Bases
Cleavable & Non-cleavable Linkers
DNA Base Analogs
Fluorescence Dyes
Fluorescence Bases
Internal Modifications
RNA Specific Capping
RNA Base Analogs
Spacer & Linkers
Sugar Modifications
Terminal Modification (Caps)
Quenchers
Intercalators
Halogenated Bases
Phosphorylation Modifier
Reactive Handlers
Redox / Electrochemical
Small Molecule Functional Tags ›

Puromycin-mRNA-Display-Signal

Modification by Property at BSI
2′→5′ phosphodiester linkage
Affinity Binding and Capturing
Affinity & Hybridization Control
Inverted Base Oligo Modifications
Cleavable Fluorescent Probes
Convertible Bases
Deuterated Bases
Degenerate Bases
Fluorescent Quenching Signal Suppression
Intercalator Base Modifications
Metal Chelation Modifications
Non-Canonical Structures
Nuclease Resistance & Stability
Photoswitchable Markers
Photo Regulation
Reverse 5' -> 3' Oligo Synthesis
Universal Bases

Modification by Application at BSI
Antisense (ASO, SSO, Gapmers)
siRNA & miRNA
Delivering and Targeting
Conjugation to Antibody (ADC/AOC)
Epigenetics
Cell Delivery and Uptake
DNA Damage Repair
DNA Cross Linking and Ligation
Mutagenesis and Methylation
Chemical Ligation
Colorimetric Detection
Ligation Blocking
Controlled Release / Cleavable Linkers
Photo-Regulation / Photo Cleavage
Structure–Activity Studies
Modification for Bioorthogonal Conjugation
Chain Terminators
Caged Oligonucleotides
Electrochemical Sensing Readout

Speciality Oligonucleotide Synthesis
Therapeutic Modalities ›
Advanced Chemistries Platforms ›
Advanced Oligo Architecture ›
Conjugation Handle Modifications ›
PCR Detection Probes ›
Hybridization Probes ›
Imaging & Spatial Biology Probes ›
PCR Clamp Technology

Custom Oligo Bioconjugation
Tissue & Receptor Targeting ›
Cellular Uptake & Intracellular Delivery ›
Oligo–Macromolecule Conjugates ›
Oligo-Drug Conjugates (ODCs) ›
Oligo-Small Molecule Conjugates ›
Polymer-Oligo Conjugates ›

Therapeutic Oligo Services
Advanced siRNA Architectures
Antisense Oligo (ASO)
Gapmer ASO
Steric-Blocking ASO
Splice-Switching Oligo (SSO)
Aptamers
miRNA Mimics
Therapeutic Oligo Bioconjugation

Tissue Receptor Targeting Oligo Services
Oligo-GalNAc Conjugation
Oligo-Folate Conjugation
Receptor-Targeting Ligand Conjugates

Cellular Uptake and Delivery Services
Extrahepatic Oligonucleotide Delivery
Peptide-Oligo Conjugates
Lipid-Conjugated Oligos ›
Endosomal Escape Options

Lipid-Modified Oligonucleotide Overview
Saturated Fatty Acid Oligos
Unsaturated Fatty Acid Oligos
Cholesterol & Sterol Oligos
Phospholipid & PEG-Lipid Oligos
Steroid & Vitamin Lipid Oligos
Specialty Lipid/ Nucleolipid Oligo

Oligo-Macromolecule at BSI
Antibody-Oligo Conjugates
Nanobody-Oligo Conjugates
Enzyme-Oligo Conjugates
Oligo–Carrier Protein Conjugates
Recombinant Protein-Oligo Conjugates
Streptavidin-Oligo Conjugates

Oligo-Drug Conjugation Services
Oligo-Drug Conjugates
Cleavable Linker Technologies
Controlled Release Strategies
Bioorthogonal Conjugation

Small Molecule Oligo Conjugates Overview
Delivery Modifiers
Targeting Ligands
Affinity Labels
Fluorescent Labeled Oligos
Biotinylated Oligos

Oligo-Polymer Conjugation Overview
Oligo-PEGylation
Oligo-Synthetic Polymer Conjugates
Oligo-PAMAM Conjugates
Oligo-Biodegradable Polymer Conjugates
Smart Polymer–Oligo Conjugates

Advanced Chemistry Platform Overview
Phosphodiester Linkage Reengineering ›
Advanced Sugar Modified XNA ›
Advance XNA Backbone Analogs
Artificial Base Pair Systems

Phosphodiester Linkage Reengineering Overview
Chiral Phosphorothioate (Rp/Sp)
Phosphonoacetate (PACE)
Phosphoramidate (PN bond)
Peptide Nucleic Acid (PNA)
Morpholino (PMO/TMO)

Sugar Modified XNAs Overview
Bridged Nucleic Acids (LNA/BNA)
Ethylene-Bridge Nucleic Acids (ENA)
Constrained Ethyl Nucleic Acids (cEt)
2'-O-NMA (NMA)
2'-Amino Nucleic Acids (2'-AmNA)
Unlock Nucleic Acids (UNA)

Advanced Oligo Architecture Overview
Circular Oligos
Branched Oligos
Dendrimer Oligonucleotide Synthesis
Multimeric Oligonucleotide Synthesis

Conjugation Handle Overview
Click Chemistry Modifier
Amino Modifiers
Thiol Modifiers
Carbonyl Reactive Modifiers
Carboxyl Modifiers
Multifunctional Modifiers
Crosslinker Modifiers

qPCR Probe Services Overview
Dual-Labeled Probe Technologies
Dual-Labeled Hydrolysis Probes
Molecular Beacon Probes
Scorpion Probes
Plexor Primer
FRET Probes
MGB Probes
Multiplex qPCR Probes
Affinity-Enhanced Probes
Mutation Detection Probes
Pathogen Detection Probes

Hybridization probe service overview
DNA/RNA hybridization probes
PNA Hybridization Probes
Branched DNA (bDNA) Probes
Telomere Probes
Capture probe
Custom Hybridization Probe Sets

Imaging & Spatial Biology Probes Overview
Fluorescent Imaging Probes
Near-Infrared (NIR) Imaging Probes
smFISH Probes
RNA Imaging Probes
MERFISH Probes
seqFISH Probes
Spatial Transcriptomic Probe Sets
OligoPaint Probes
Chromosome Painting Probes
Telomere PNA FISH Probes
Custom Imaging Probe Design

Formulation & Product Development at BSI
Custom Formulation Development
LNP Encapsulation
Packaging & Fill-Finish

PeptideTech at BSI
Research Use Peptides (RUO)
Therapeutic/Clinical Peptides
Diagnostic Peptides
Peptide Release QC

Custom Peptide Synthesis Overview
Standard Peptides
Custom Peptide Libraries
Custom Peptide Arrays
Large-Scale Manufacturing
Long Peptides
Difficult Peptides ›

Hydrophobic Peptides
Cysteine-rich Peptides
Aggregation-prone Peptides

Hydrophobic Peptides
Aggregation-prone Peptides

Peptide Modification Overview
Structural Modifications ›
Functional Modifications ›
Conjugation Chemistry ›
Biological Modifications ›

Structural Modifications Overview
Terminal Modifications ›
Amino Acid Substitutions ›
Backbone Modifications
Side-Chain Functionalization ›
Peptide Cyclization ›

Terminal Modification Overview
N-terminus Modification
C-terminus Modification

Amino Acid Substitution Overview
Stereochemical D-Amino Acids
Non-Proteinogenic (Unnatural) Amino Acids

Side-Chain Functionalization Overview
Cysteine-Specific Chemistry
Lysine-Selective Chemistry

Cyclic Peptide Modification Overview
Head-to-tail Cyclization
Side-chain Cyclization
Terminus-to-side Chain Cyclization

Fluorescent Labeling modification
Stable Isotope Labeling
PEGylation
Biotinylation
Click Chemistry Modifications
Linkers, Spacers & Crosslinking
Site-Specific Peptide Modification
Cleavable & Stimuli-Responsive Linkers
Targeting & Delivery Modification

Peptide Crosslinking Chemistry

Post-Translational Modifications
PTM Overview
Phosphorylated Peptides
Glycopeptides
Acetylated Peptides
Methylated Peptides
Sulfated Peptides
Citrullinated Peptides
Ubiquitinated Peptides
SUMOylated Peptides

Peptide Purification Services
Peptide Analytical Services

Specialized Peptide Technologies Overview
Architecture Engineered Peptides ›
Conformational Engineered Peptides ›
Hybrid Peptide Architecture ›
Functionally Engineered Peptides ›
Advanced Peptide Design & Discovery

Architecture Engineered Peptides Overview
Branched Peptide Synthesis
Multivalent Peptide Synthesis ›

Multivalent Peptides Overview
Multiple Antigen Peptide (MAPs)
Dendrimer Peptides
Multiepitope Peptides
Bispecific Peptides

Conformational Engineered Peptides Overview
Cyclic Peptides
Staple Peptides
Helical Peptides
Macrocyclic Peptides
Bicyclic Peptide

Hybrid Peptide Architecture Overview
Glycopeptides
Lipopeptides
PEGylated Peptides

Functionally Engineered Peptides Overview
Analytical & Quantitative Peptide ›
Detection & Reporter Peptides ›
Affinity & Captured Peptides ›

Targeted Proteomics & Quantitative LC-MS Peptides
Stable Isotope-Labeled Peptides
AQUA Peptides

Detection & Reporter Peptides Overview
Fluorescent-Labeled Peptides
FRET Peptides
Enzyme Reporter Peptides
Photoreactive Peptides

Biotinylated Peptides
Affinity Tag Peptides

Catalog Peptide Libraries
MOG Peptide
Beta Amyloid
Cosmetic Peptide
More Catalog Peptide Listing...

Peptide Bioconjugation
Peptide-Oligonucleotide Conjugation ›
Peptide-Protein Conjugation ›
Peptide-Polymer Conjugation ›
Peptide-Drug Conjugation ›
Peptide-Small Molecule/Ligand Conjugation (Non-Drug) ›
Peptide Imaging Conjugates ›

Peptide-Oligo Overview
Peptide-siRNA Conjugation
Peptide-DNA Conjugation
Peptide-ASO Conjugation
Peptide-PNA Conjugation
Peptide-PMO Conjugation

Peptide-Protein Overview
Peptide Carrier Protein Conjugation
Peptide Enzyme Conjugation
Peptide Antibody Conjugation
Peptide–Recombinant Protein Conjugation

Peptide-Polymer Conjugation Overview
Peptide-PEGylation
Peptide–Synthetic Polymer Conjugation
Peptide–Biodegradable Polymer Conjugation

Peptide–Drug Conjugates (PDCs) Overview
Peptide–Lipid Drug Conjugates
Cleavable Linker Peptide–Drug Conjugates (PDCs)
Site-Specific Peptide-Drug
Oncology Peptide Drug Conjugates

Peptide-Small Molecule/Ligand Overview
Peptide–Fluorophore Conjugates
Peptide–Affinity Tag Conjugates
Peptide–Vitamin / Cofactor Conjugates
Peptide–Targeting Ligand Conjugates
Glycopeptide
Lipopeptide (Peptide-Lipid)
Peptide GalNAc Conjugates

Peptide-Imaging Conjugate Overview
Peptide-Fluorophore Conjugates
Near-infrared Peptide Conjugates
Radiolabeled-Compatible (Chelate) Peptides
Dual-label Imaging Conjugates

Molecular Biology Services at BSI
Long RNA Transcript Services
mRNA Transcription Services
Gene and DNA Synthesis
Cloning & Vector Construction
Plasmid DNA Preparation
Protein Expression
Recombinant Protein Purification
RNA & Protein Delivery (LNP Formulation)
Protein Modification & Bioconjugation

Conjugation Service Overview
Site-Specific Conjugation
Payloads, Label & Tags
Cross Linkers, Spacers
Chemistries & Reactive Handles
Carrier & Delivery System
Surfaces & Solid-Support
Development & scale-up
Analytical Characterization
Application Based Conjugation

Biomolecule Conjugates
Antibody Bioconjugates
Oligo Conjugates
Peptide Bioconjugates
Protein Conjugates
Drug Bioconjugates (ODC)
Small Molecule/Hapten Conjugates
Polymer Bioconjugation ›
Lipid & Liposome Bioconjugates
Glycoconjugates
Nanomaterials ›
Metal Chelator Bioconjugates

Polymer Bioconjugation Overview
PEGylation Bioconjugation
Synthetic Polymer Bioconjugation
Biodegradable Polymer Bioconjugation

Nanomaterials Overview
Gold Nanoparticle Bioconjugation

Antibody Purification
Antibody Characterization
ELISA Development & Optimization

Antibody Engineering and Conjugation Overview
Fluorescent Labeling
Secondary Detection Probes
Enzyme Labeling (HRP, AP)
Biotin Conjugation
Nanoparticle Conjugation
Oligonucleotide Conjugation
Antibody Drug Bioconjugation (ADC)
Small Molecule / Ligand Conjugation
Liposome Conjugation
Polymer Conjugation
Fragmentation

Amino Acid Analysis
Endotoxin Assay
Mass Spectrometry
Peptide Identity Confirmation
Peptide Counterion Analysis
Bioburden Assay
Salt-Sodium Content Analysis
Water Content Analysis
Residual Chemical Analysis
pH Analysis
Solubility Testing
Time-Schedule Stability Study
Customer / Bundled Panel

Custom Solutions

Designed for your research & pipeline

High Quality

Rigorous QC and on-time delivery

Scalable Manufacturing

From bench-scale to commercial scale

Expert Support

Scientist-to-scientist consultation

Need help finding the right solution?

Speak to a Scientist →

Resources

Educational Resources ›
Scientific Tools ›

Educational Articles
Frequently Asked Questions
Literature Vault
Newsletters

Oligo Properties Calculator
Peptide Properties Calculator
Peptide Design Library
PNA Properties Calculator
Bioinformatic Glossary
Genetic Code Table
Unit Conversion Tables

Free Tools

Scientific Resources

Calculators, design tools, and educational content to support your research.

Explore →

Contact Quote Order Login / Register

Viral, Microbial & Parasite Enzymes Products

Viral, Microbial & Parasite Enzymes

Anti-HIV Peptides

Hepatitis C Virus (HCV) Peptides

Hepatitis C Virus (HCV) Related Peptides

HIV Related Peptides

HSV-1 Proteinase Substrates

Human Herpes Virus 8 (HHV-8) Protease Substrate

Human Rhinovirus-14 (HRV14) 2A Protease Substrates

Human Rhinovirus-14 (HRV14) 3C Protease Substrates

Malaria Aspartyl Proteinase Substrate

Viral Peptides

ALL

αβδγ

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

Product Name	Catalog #	Unit	Price/Unit
4A/4B, 5A/5B Peptide Ac-DEMEECSMSY-CONH2	11240-01	1 mg	$1,452	Cart Inquire
4A/4B Peptide (1) DEMEECSQHLPYI	11236-01	1 mg	$1,452	Cart Inquire
4A/4B Peptide (2) DEMEECASHLPY-K(Ac)-CONH2	11237-01	1 mg	$1,452	Cart Inquire
4A/4B Peptide (3), EDANS - labeled DEMEECASHLPY-E(EDANS)-CONH2	11238-01	1 mg	$1,688	Cart Inquire
4B/5A Peptide ECTTPCSGSWLRD	11239-01	1 mg	$1,250	Cart Inquire
5A/5B Peptide (1) EDVV-Abu-CSMSY	11234-01	1 mg	$1,250	Cart Inquire
5A/5B Peptide (2) Ac-EEVVAC-AMC	11225-01	1 mg	$845	Cart Inquire
5A/5B Peptide (3) Ac-EEVVAC-pNA	11226-01	1 mg	$795	Cart Inquire
5A/5B Peptide (4) K(Biotin)-KEDVV-Abu-CS-Abu-SYKK-CONH2	11227-01	1 mg	$1,182	Cart Inquire
Ac - 5A/5B Peptide Ac-EDVVCCSMSY-CONH2	11235-01	1 mg	$1,350	Cart Inquire
C34 gp41 HIV Fragment WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL	12147-01	1 mg	$986	Cart Inquire
C34 - LC - Biotin, gp41 HIV fragment WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC-Biotin)	12148-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 01 MEPVDPRLEPWKHPG	11464-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 02 DPRLEPWKHPGSQPK	11465-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat -03 EPWKHPGSQPKTACT	11466-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 04 HPGSQPKTACTNCYC	11467-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 05 QPKTACTNCYCKKCC	11468-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 10 CFTTKGLGISYGRKK	11473-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 11 KGLGISYGRKKRRQR	11474-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 12 ISYGRKKRRQRRRAP	11475-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 13 RKKRRQRRRAPQDSQ	11476-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 14 RQRRRAPQDSQTHQV	11477-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 15 RAPQDSQTHQVSLSK	11478-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 16 DSQTHQVSLSKQPAS	11479-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 17 HQVSLSKQPASQPRG	11480-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 18 LSKQPASQPRGDPTG	11481-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 19 PASQPRGDPTGPKES	11482-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 20 PRGDPTGPKESKKKV	11483-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 21 PTGPKESKKKVERET	11484-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 22 KESKKKVERETETDP	11485-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 23 KKVERETETDPVDQ	11486-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 6 ACTNCYCKKCCFHCQ	11469-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 7 CYCKKCCFHCQVCFT	11470-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 8 KCCFHCQVCFTTKGL	11471-01	1 mg	$1,098	Cart Inquire
CONSENSUS B Tat - 9 HCQVCFTTKGLGISY	11472-01	1 mg	$1,098	Cart Inquire
Cys(Npys) - TAT (47 - 57) FAM - labeled C(Npys)YGRKKRRQRRR - K(FAM) - NH2	14489-01	1 mg	$966	Cart Inquire
Cys - TAT (47 - 57) CYGRKKRRQRRR-CONH2	12134-01	1 mg	$405	Cart Inquire
EFDEMEECASHLPYI EFDEMEECASHLPYI	11224-01	1 mg	$743	Cart Inquire
FITC - LC - TAT (47 - 57) FITC - LC - YGRKKRRQRRR - NH2	14370-01	1 mg	$801	Cart Inquire
G9 - 209 - 2L3W HIV ILWQVPFSV	12143-01	1 mg	$761	Cart Inquire
Gag Spacer Peptide P1 HHHHHHIIKIIK	14738-01	1 mg	$405	Cart Inquire
gp120, HIV - 1 MN YNAKRKRIHIQRGPGRAFYTTKNII	11273-01	1 mg	$1,148	Cart Inquire
GP120 - W61D - 1 MKVKETRKNYQHLWR	11279-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 100 LFNSTWNGTEGNNTE	11378-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 101 TWNGTEGNNTEGNST	11379-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 102 TEGNNTEGNSTITLP	11380-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 103 NTEGNSTITLPCRIK	11381-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 104 NSTITLPCRIKQIIN	11382-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 105 TLPCRIKQIINMWQE	11383-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 106 RIKQIINMWQEVGKA	11384-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 107 IINMWQEVGKAMYAP	11385-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 107 - S WQEVGKAMYAP	11412-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 108 WQEVGKAMYAPPIGG	11386-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 109 GKAMYAPPIGGQIRC	11387-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 11 VPVWKEATTTLFCAS	11289-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 110 YAPPIGGQIRCSSNI	11388-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 111 IGGQIRCSSNITGLL	11389-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 112 IRCSSNITGLLLTRD	11390-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 113 SNITGLLLTRDGGTE	11391-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 114 GLLLTRDGGTEGNGT	11392-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 115 TRDGGTEGNGTENET	11393-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 116 GTEGNGTENETEIFR	11394-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 117 NGTENETEIFRPGGG	11395-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 118 NETEIFRPGGGDMRD	11396-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 120 GGGDMRDNWRSELYK	11398-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 122 WRSELYKYKVVKVEP	11400-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 123 LYKYKVVKVEPLGVA	11401-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 124 KVVKVEPLGVAPTRA	11402-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 125 VEPLGVAPTRAKRRV	11403-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 126 GVAPTRAKRRVVQR	11404-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 15 AKAYDTEVHNVWATH	11293-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 16 DTEVHNVWATHACVP	11294-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 17 HNVWATHACVPTDPN	11295-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 18 ATHACVPTDPNPQEV	11296-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 19 CVPTDPNPQEVVLGN	11297-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 2 ETRKNYQHLWRWGTM	11280-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 20 DPNPQEVVLGNVTEY	11298-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 21 QEVVLGNVTEYFNMW	11299-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 22 LGNVTEYFNMWKNNM	11300-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 23 TEYFNMWKNNMVDQM	11301-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 24 NMWKNNMVDQMHEDI	11302-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 25 NNMVDQMHEDIISLW	11303-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 26 DQMHEDIISLWDQSL	11304-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 26 - S DQMHEDIISLW	11407-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 3 NYQHLWRWGTMLLGM	11281-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 30 PCVKLTPLCVTLDCD	11308-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 31 LTPLCVTLDCDDVNT	11309-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 32 CVTLDCDDVNTTNST	11310-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 33 DCDDVNTTNSTTTTS	11311-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 34 VNTTNSTTTTSNGWT	11312-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 35 NSTTTTSNGWTGEIR	11313-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 36 TTSNGWTGEIRKGEI	11314-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 37 GWTGEIRKGEIKNCF	11315-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 38 EIRKGEIKNCFFNIT	11316-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 39 GEIKNCFFNITTSIR	11317-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 4 LWRWGTMLLGMLMIC	11282-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 40 NCFFNITTSIRDKVQ	11318-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 41 NITTSIRDKVQKEYA	11319-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 42 SIRDKVQKEYALFYN	11320-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 43 KVQKEYALFYNLDVV	11321-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 44 EYALFYNLDVVPIDD	11322-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 45 FYNLDVVPIDDDNAT	11323-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 46 DVVPIDDDNATTKNK	11324-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 47 IDDDNATTKNKTTRN	11325-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 48 NATTKNKTTRNFRLI	11326-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 49 KNKTTRNFRLIHCNS	11327-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 5 GTMLLGMLMICSAAE	11283-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 50 TRNFRLIHCNSSVMT	11328-01	1 mg	$1,098	Cart Inquire
GP120 - W61D - 5 - S LGMLMICSAAE	11405-01	1 mg	$1,098	Cart Inquire
HCV - 1 e2 Protein (484 - 499) PYCWHYPPKPCGIVPA	11252-01	1 mg	$777	Cart Inquire
HCV Core Protein (1 - 20) MSTNPKPQRKTKRNTNRRPQ	11250-01	1 mg	$845	Cart Inquire
HCV (Hepatitis C Virus) NS3/4A Protease Substrate Ac - DE - Dap(QXL® 520) - EE - Abu - ψ - [COO]AS - C(5 - FAMsp) - NH2	14582-01	1 mg	$2,435	Cart Inquire
HCV, NS4A - Like Peptide KKGSVVIVGRIVLSGKPAIIPKK	11249-01	1 mg	$1,013	Cart Inquire
HCV Protease FRET Substrate (RET S1) Ac - DE - D(Edans) - EE - Abu - ψ - [COO] - AS - K(Dabcyl) - NH2	14583-0.25	0.25 mg	$594	Cart Inquire
HCV Protease FRET Substrate (RET S1)	14584-01	1 mg	$1,952	Cart Inquire
Hepatitis Virus C NS3 Protease Inhibitor 2 Ac - DE - Dif - E - Cha - C	14585-01	1 mg	$1,412	Cart Inquire
NS4A - NS4B Hepatitis Virus C, NS3 Protease Inhibi Ac-DEMEEC	11241-01	1 mg	$1,115	Cart Inquire
PEP1 SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-CONH2	11245-01	1 mg	$966	Cart Inquire
Pep 4A GSVVIVGRIILSGR-CONH2	11232-01	1 mg	$1,317	Cart Inquire
Pep 4AK KKKGSVVIVGRIILSGR-CONH2	11233-01	1 mg	$1,452	Cart Inquire

Show Rows :

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45 years of delivering high-quality, fast, and scalable synthetic biology solutions.

Greetings, Researchers,

Please be advised that any information, guidelines, write-ups, and oral/video/graphic content on our website are intended solely as general guidelines.

It is the researcher's sole responsibility to conduct thorough research on the design of products intended for their experiments before submitting
their designs to Biosynthesis for production feasibility review.

Thank you for your understanding.

Quick Links

Email : info@biosyn.com
Toll Free: 800.227.0627 | 1.972.420.8505
Bio-Synthesis Inc, 800 Mario Court, Lewisville, TX 75057