Live Chat Support Software
800.227.0627

Chemopreventive peptides are peptides that help prevent the onset or development of a disease such as cancer or diabetes. These peptides can either originate from natural sources, for example from soy or milk, from the design of peptide mimetics, or from peptide screens using synthetic peptides. It is thought that some of these peptides may function as modulators of the cell-cycle that regulates the production and function of proteins needed to advance cells through the replication cycle. In addition, there is now increased evidence that specific dietary pattern, foods and drinks, and other dietary substances can and do protect against cancer. More and more epidemiological studies suggest that food, nutrition and physical activity are important in the prevention and modification of the cancer process. Different types of food proteins and peptides that include plant protease inhibitors, lactoferrin, lactoferricin, lectins and lunasin appear to act as chemopreventive agents. Proteins and peptides are now considered as one group of nutraceuticals that show potential in preventing different stages of cancer including initiation, promotion and progression. Furthermore, some protease inhibitors found in plants such as legumes and soy beans have been found to be effective suppressors of carcinogenesis. Carcinogenesis is the process of initiating and promoting cancer. The Bowman-Birk inhibitor and the Kunitz trypsin inhibitors are among them. Presently the biological function of these compounds in carcinogenesis is mainly attributed to suppress invasion and metastasis of cancer cells, however, the mechanisms of action are still not fully known and further research is needed to fully elucidate them.

Bio-Synthesis offers wide selection of cancer research peptides. If you can’t find what you are looking for, we can provide our custom services. Our cancer research peptides are synthesized under stringent quality control with purity >95%. Large scale can be prepared through our custom synthesis services.

ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
234 CM - Cancer Research Peptides
KYICNSSCM
10582-01 1 mg $220 cart inquire
234 CW
KYMCNSSCM
10583-01 1 mg $220 cart inquire
[ - 2] pPSA, Prostate - Specific Antigen, truncate
SRIVGGWECEK
10559-01 1 mg $245 cart inquire
[ - 4]pPSA
ILSRIVGGWECEK
10561-01 1 mg $255 cart inquire
[A90,95] Bid BH3 (77 - 100), mouse
ESQEEIIHNIARHAAQIGAEMDHN
10701-01 1 mg $310 cart inquire
Adipophilin
SVASTITGV
10591-01 1 mg $220 cart inquire
AH1 Sequence (6 - 14)
SPSYVYHQF
14297-01 1 mg $120 cart inquire
[Ala6, Val15] MUC5AC Analog 2
GTTPSAVPTTSTTSVP
10570-01 1 mg $230 cart inquire
Amphoterin (150–183)
KLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKK
10568-01 1 mg $395 cart inquire
Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
10681-01 1 mg $380 cart inquire
anti - Flt1 peptide
GNQWFI
10581-01 1 mg $200 cart inquire
[APLILSR]pPSA
APLILSRIVGGWECEK
10560-01 1 mg $260 cart inquire
[Arg67]Bax H2-H3 (53-86), [R67] Helix 2-3 (53-86)
DASTKKLSECLKRIRDELDSNMELQRMIAAVDTD
10707-01 1 mg $395 cart inquire
(Asn370) Tyrosinase (368-376) Peptide
YMNGTMSQV
10605-01 1 mg $240 cart inquire
[Asp370] Tyrosinase (368 - 376) Peptide
YMDGTMSQV
10596-01 1 mg $120 cart inquire
Bad (103-127), human, all d-isomers
nlwaaqrygrelrrmsdefvdsfkk
10705-01 1 mg $370 cart inquire
BAD BH3 (103-123)
NLWAAQRYGRELRRMSDEFVD
10720-01 1 mg $295 cart inquire
BAD BH3 (146-159)
RYGRELRRMSDEFE
10714-01 1 mg $220 cart inquire
BAD (CT-1)
KKGLPRPKSAGTATQMRQSSSWTC-CONH2
10689-01 1 mg $310 cart inquire
BAD Peptide, biotin-labeled
Biotin-LC-AGAGRSRHSSYPAGT
10688-01 1 mg $250 cart inquire
BAFF-R (160-183)
SVPVPATELGSTELVTTKTAGPEQ
10726-01 1 mg $310 cart inquire
BAGE (2 - 10)
AARAVFLAL
10630-01 1 mg $230 cart inquire
Bak - BH3
GQVGRQLAIIGDDINR
10646-01 1 mg $120 cart inquire
Bak BH3 (67-87)
PSSTMGQVGRQLAIIGDDINR
10722-01 1 mg $295 cart inquire
Bak-BH3 (69-93)
STMGQVGRQLAIIGDDINRRYDSEF
10690-01 1 mg $315 cart inquire
Bak BH3 (71-89)
MGQVGRQLAIIGDDINRRY
10680-01 1 mg $245 cart inquire
Bak-BH3 peptide, Mca labeled
7-methoxycoumarine-4-yl acetyl (Mca)-GQVGRQLAIIGDDINR
10668-01 1 mg $270 cart inquire
Bak-BH3 TAMRA-labeled
GQVGRQLAIIGDDINR-K(TAMRA)-CONH2
10473-01 0.1 mg $232 cart inquire
Bax I
PQDASTKKLSECLKRIGDELDSNMEL
10687-01 1 mg $315 cart inquire
Bax - BH3
KKLSECLKRIGDELDS
10647-01 1 mg $230 cart inquire
Bax BH3 (58-71)
KLSECLKRIGDELD
10717-01 1 mg $220 cart inquire
Bax - BH3L63A
KKLSECAKRIGDELDS
10648-01 1 mg $230 cart inquire
Bax BH3 peptide (55-74), wild type
STKKLSECLKRIGDELDSNM
10685-01 1 mg $250 cart inquire
Bax H2-H3 (53-86), Helix 2-3
DASTKKLSECLKRIGDELDSNMELQRMIAAVDTD
10699-01 1 mg $390 cart inquire
Bax H3 (71-86), Helix 3 (71-86)
DSNMELQRMIAAVDTD
10724-01 1 mg $240 cart inquire
Bcl-2 BH3 (85-105)
ALSPVPVVHLTLRQAGDFSRR
10723-01 1 mg $295 cart inquire
Bcl-2 BH3 Peptide II
LSPVPPVVHLALRQAGDDFSRRYRG
10691-01 1 mg $315 cart inquire
Bcl - 2 Binding Peptide Bad BH3 Peptide
LWAAQRYGRELRRMSDEFEGSFKGL
14298-01 1 mg $193 cart inquire
Bcl 9-2 (10692-005)
GSEGLSKEQLEHRERSLQTLRDIERLLLRSGETEPFLKGPPGGAG-CONH2
10692-005 0.5 mg $330 cart inquire
Bcl9-2, mutant
GSEGLSKEQLEHRERSFQTLRDIERLLLRSGETEPFLKGPPGGAG-CONH2
10693-005 0.5 mg $310 cart inquire
Bcl-XL BH3 (85-98)
AVKQALREAGDEFE
10713-01 1 mg $225 cart inquire
BDC2.5(A)
GKKVAAPAWARMG
10643-01 1 mg $225 cart inquire
BH3 BIM Peptide (52-71), human-10712-01
Ac-MRPEIWIAQELRRIGDEFNA
10712-01 1 mg $250 cart inquire
Bid - BH3
RNIARHLAQVGDSMDR
10649-01 1 mg $230 cart inquire
Bid BH3 (77-100), mouse
ESQEEIIHNIARHLAQIGDEMDHN
10700-01 1 mg $310 cart inquire
Bid BH3 (79-99)
QEDIIRNIARHLAQVGDSMDR
10719-01 1 mg $295 cart inquire
Bid BH3 (85-98)
NIARHLAQVGDSMD
10716-01 1 mg $220 cart inquire
Bid BH3, FAM labeled
5-FAM-EDIIRNIARHLAQVGDSMDR
10654-01 1 mg $400 cart inquire
Bid BH3 Peptide
EDIIRNIARHLAQVGDSMDR
10653-01 1 mg $116 cart inquire
Bid BH3, Peptide II, TAMRA labeled
5-TAMRA-EDIIRNIARHLAQVGDSMDR
10694-01 1 mg $350 cart inquire
Bid BH3 - r8
rrrrrrrr - GEDIIRNIARHLAQVGDSMDR
14299-005 0.5 mg $358 cart inquire
Bid BH3-R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
10671-01 1 mg $340 cart inquire
Bid BH3 - R9
RRRRRRRRRGEDIIRNIARHLAQVGDSMDR
10655-01 1 mg $340 cart inquire
Bik BH3 (50-70)
CMEGSDALALRLACIGDEMDV
10721-01 1 mg $295 cart inquire
Bik BH3 (56-69)
ALALRLACIGDEMD
10718-01 1 mg $220 cart inquire
Bim BH3 (87-100)
WIAQELRRIGDEFN
10715-01 1 mg $220 cart inquire
Bim BH3, Fragment II, TAMRA labeled
5-TAMRA-MRPEIWIAQELRRIGDEFNA
10684-005 0.5 mg $300 cart inquire
Bim BH3 Fragment I, TAMRA labeled
5-TAMRA-DNRPEIWIAQELRRIGDEFNAYYAR
10683-005 0.5 mg $310 cart inquire
Bim BH3, Peptide III
DMRPEIWIAQELRRIGDEFNAYYAR
10695-01 1 mg $193 cart inquire
Bim BH3, Peptide IV
DMRPEIWIAQELRRIGDEFNAYYARR
10696-01 1 mg $198 cart inquire
BMf-BH3
LQHRAEVQIARKLQCIADQFHRLHT
10697-01 1 mg $315 cart inquire
BRCAA1 (610-619)
SSKKQKRSHK
10728-01 1 mg $215 cart inquire
[C92,96] Bid BH3 (77-100), mouse
ESQEEIIHNIARHLACIGDCMDHN
10702-01 1 mg $310 cart inquire
Lunasin Peptide
NH2-SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD-COOH
14253-001 1 mgs $450 cart inquire
CEA, CAP - 1 - 6 - D, [Asp6] - Carcinoembryonic An
YLSGADLNL
10553-01 1 mg $240 cart inquire
CEA Related, QYSWFVNGTF
QYSWFVNGTF
10556-01 1 mg $210 cart inquire
CEA Related, TYACFVSNL
TYACFVSNL
10555-01 1 mg $240 cart inquire
c - Myc peptide epitope
EQKLISEEDL
10544-01 1 mg $120 cart inquire
c - Myc peptide epitope (10544-05)
EQKLISEEDL
10544-05 5 mg $120 cart inquire
Cripto - 1, CR - 1
CPPSFYGRNCEHDVRKE
10551-01 1 mg $285 cart inquire
CTT, Gelatinase Inhibitor
CTTHWGFTLC (Disulfide Bridge: 1-10)
10670-01 1 mg $245 cart inquire
[Cys92]Bid BH3 (77-100), mouse
ESQEEIIHNIARHLACIGDEMDHN
10703-01 1 mg $310 cart inquire
[Cys96]Bid BH3, mouse
ESQEEIIHNIARHLAQIGDCMDHN
10704-01 1 mg $310 cart inquire
[Cys(Acm)33]-Endostatin (6-49)
FQPVLHLVALNSPLSGGMRGIRGADFQ-C(Acm)-FQQARAVGLAGTFRAF
10657-005 0.5 mg $335 cart inquire
E7 (43–62), HPV Oncoprotein
GQAEPDRAHYNIVTFCCKCD
10665-01 1 mg $250 cart inquire
E7 (43–77), HPV Oncoprotein
GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR
10666-01 1 mg $445 cart inquire
E75, Her - 2/neu (369 - 377)
KIFGSLAFL
10594-01 1 mg $220 cart inquire
EGFR (662-681)
RRELVEPLTPSGEAPNQALLR
10667-01 1 mg $295 cart inquire
Enhanced Green Fluorescent Protein, EGFP (200 - 208)
HYLSTQSAL
14300-01 1 mg $120 cart inquire
Ep - CAM (263 - 271)
GLKAGVIAV
10558-01 1 mg $220 cart inquire
G154, gp100 (154-162)
KTWGQYWQV
10562-01 1 mg $260 cart inquire
G209-2M, gp100 (209-217)
IMDQVPFSV
10564-01 1 mg $120 cart inquire
G209, gp100 (209-217)
ITDQVPFSV
10563-01 1 mg $240 cart inquire
G280-9, gp100 (280-288), Lys (biotin)
YLEPGPVTA-K(Biotin)
10566-01 1 mg $240 cart inquire
G280-9V, gp100(280-288) Lys(biotin)
YLEPGPVTV-K(Biotin)
10565-01 1 mg $240 cart inquire
GAD65 (206 - 220)
TYEIAPVFVLLEYVT
10642-01 1 mg $240 cart inquire
GAD65 (78–97)
KPCNCPKGDVNYAFLHATDL
10641-01 1 mg $270 cart inquire
[Gln340]-Maspin, Reactive Site Loop (RSL), (330-34
GGDSIEVPGAQILQHK
10729-01 1 mg $230 cart inquire
[Glu63] Bax BH3, mutant
STKKLSECEKRIGDELDSNM
10686-01 1 mg $250 cart inquire
GnT - V (nt38 - 67)
VLPDVFIRCV
10607-01 1 mg $230 cart inquire
gp100 (177–186)
AMLGTHTMEV
10633-01 1 mg $245 cart inquire
gp100 (178 - 187)
MLGTHTMEV
10617-01 1 mg $230 cart inquire
gp100 (25–33), human
KVPRNQDWL
10730-01 1 mg $120 cart inquire
gp100 (457 - 466)
LLDGTATLRL
10604-01 1 mg $215 cart inquire
gp100 (476 - 485)
VLYRYGSFSV
10616-01 1 mg $230 cart inquire
gp100 (570–579)
SLADTNSLAV
10615-01 1 mg $230 cart inquire
gp100 (614–622)
LIYRRRLMK
10612-01 1 mg $210 cart inquire
gp100 (619–627)
RLMKQDFSV
10614-01 1 mg $210 cart inquire
gp100 (639–647)
RLPRIFCSC
10613-01 1 mg $230 cart inquire
GPC3 (144 - 152)
FVGEFFTDV
10602-01 1 mg $220 cart inquire
GPC3 (298 - 306), mouse
EYILSLEEL
10603-01 1 mg $230 cart inquire
GRP78 Binding Chimeric Peptide Motif (10679-01)
WIFPWIQL-GG- klaklakklaklak-CONH2
10679-01 1 mg $310 cart inquire
HB-1 (26-41)
EDDVYLRHSSSLTYRL
10725-01 1 mg $230 cart inquire
HER - 2/Neu (654 - 662), GP2
IISAVVGIL
10557-01 1 mg $220 cart inquire
HIF - 1 {alpha} (556 - 574)
DLDLEMLAPYIPMDDDFQL
10644-01 1 mg $122 cart inquire
HIF - 2 (66 - 84)
SLEAQGIKADRETVAVKPT
10645-01 1 mg $245 cart inquire
Human PD - L1 inhibitor I  NEW
14301-01 1 mg $150 cart inquire
Human PD - L1 inhibitor II  NEW
14302-01 1 mg $150 cart inquire
Human PD - L1 inhibitor III  NEW
14303-01 1 mg $150 cart inquire
Human PD - L1 inhibitor IV  NEW
14304-01 1 mg $185 cart inquire
Human PD - L1 inhibitor V  NEW
14305-01 1 mg $120 cart inquire
IL-11R-alpha Binding Peptide II
CGRRAGGSC (S-S bonded)
10678-01 1 mg $250 cart inquire
[Ile12, Val15] MUC5AC Analog 3
GTTPSPVPTTSITSVP
10571-01 1 mg $230 cart inquire
[Ile161]MAGE-A2 (157-166)
YLQLIFGIEV
10632-01 1 mg $245 cart inquire
iLRP1, iLRP, Immature Laminin Receptor Protein (58-66)
LLLAARAIV
13696-01 1 mg $115 cart inquire
iLRP2, iLRP (60 - 68)
LAARAIVAI
10651-01 1 mg $210 cart inquire
iLRP2, iLRP (60-68)
LAARAIVAI
13698-01 1 mg $115 cart inquire
iLRP3, iLRP(146 - 154 )10650-01
ALCNTDSPL
10650-01 1 mg $230 cart inquire
iLRP3, iLRP(146 - 154 )
ALCNTDSPL
13697-01 1 mg $140 cart inquire
iLRP4, iLRP(7 - 15)
VLQMKEEDV
10652-01 1 mg $220 cart inquire
iLRP4, iLRP(7-15)
VLQMKEEDV
13700-01 1 mg $95 cart inquire
IP3 peptide, Acetylated and Biotinylated
Ac-MPRFMDYWEGLNK-K(Biotin)
10590-01 1 mg $270 cart inquire
IP3 peptide, (Lys)TAMRA labeled
MPRFMDYWEGLN-K(5/6-TMR)
10589-01 1 mg $330 cart inquire
IP3 Truncated Peptide, Acetylated
Ac-FMDYWEGLN
10588-01 1 mg $210 cart inquire
Kisspeptin - 10 (Kp - 10) Metastin (110 - 119), amide, mouse, rat
YNWNSFGLRY - NH2
14306-01 1 mg $120 cart inquire
Kisspeptin - 10 (Kp - 10) Metastin (45 - 54)
YNWNSFGLRF
14307-01 1 mg $120 cart inquire
KM - HN - 1(107 - 116)
VFGTRIEKDL
10636-01 1 mg $220 cart inquire
KM - HN - 1(196 - 204)
NYNNFYRFL
10634-01 1 mg $210 cart inquire
KM - HN - 1(335 - 343)
HFCRKCKKL
10637-01 1 mg $245 cart inquire
KM - HN - 1(499 - 508)
EYSKECLKEF
10638-01 1 mg $245 cart inquire
KM - HN - 1(65 - 74)
SFQALRMQTL
10635-01 1 mg $225 cart inquire
KM - HN - 1(770 - 778)
EYLSLSDKI
10639-01 1 mg $220 cart inquire
Laminin Peptide
CDPGYIGSR-amide
13694-01 1 mg $100 cart inquire
Livin7, ML - IAP
KWFPSCQFLL
10595-01 1 mg $240 cart inquire
LyP-1, Peptide 2
CGNKRTRGC
10677-01 1 mg $116 cart inquire
MAGE - 1 (161 - 169)
EADPTGHSY
10606-01 1 mg $230 cart inquire
MAGE - 1 (230–238 )
STAPPAHGV
10578-01 1 mg $220 cart inquire
MAGE3 (112 - 120)
KVAELVHFL
10620-01 1 mg $220 cart inquire
MAGE-3 (161-169)
EVDPIGHLY
10576-01 1 mg $220 cart inquire
MAGE - 3 (271 - 279)
FLWGPRALV
10577-01 1 mg $120 cart inquire
MAGE - A1 (237 - 245)
KLLTQDLVQ
10618-01 1 mg $220 cart inquire
MAGE-A 1(96–104)
SLFRAVITK
10733-01 1 mg $210 cart inquire
MAGE-A1 Antigen (278-286); human
KVLEYVIKV
10709-01 1 mg $210 cart inquire
MAGE - A2 (112 - 120)
KMVELVHFL
10619-01 1 mg $220 cart inquire
MAGE - A2 (157 - 166)
YLQLVFGIEV
10631-01 1 mg $240 cart inquire
MAGE - A3 (167 - 176)
MEVDPIGHLY
10627-01 1 mg $240 cart inquire
MAGE - A3 (195 - 203)
IMPKAGLLI
10628-01 1 mg $210 cart inquire
MAGE-A4 Antigen (230-239), human
GVYDGREHTV
10708-01 1 mg $215 cart inquire
MAGE - C2 (336–344)
ALKDVEERV
10597-01 1 mg $220 cart inquire
Melan - A/MART - 1 (24 - 34)
AEEAAGIGILT
10611-01 1 mg $230 cart inquire
Melanosomal Antigen II
DAEKCDKTDEY
10626-01 1 mg $245 cart inquire
MUC - 1 (9 - 17)
STAPPAHGV
10579-01 1 mg $220 cart inquire
MUC1 mucin core
GVTSAPDTRPAPGSTA
10548-01 1 mg $127 cart inquire
MUC1, tandem repeat fragment
PDTRPAPGSTAPPAHGVTSA
10593-01 1 mg $116 cart inquire
MUC5AC - 13
GTTPSPVPTTST - T* - SAP
14309-01 1 mg $242 cart inquire
MUC5AC 3
GT - T* - PSPVPTTSTTSAP
14308-01 1 mg $242 cart inquire
MUC5AC - 3/13
GT - T* - PSPVPTTST - T* - SAP
14310-01 1 mg $396 cart inquire
MUC5AC, Analog 1
GTTPSPVPTTSTTSAP
10569-01 1 mg $120 cart inquire
MUC5AC, Analog B
TTSTTSAPTTS
10575-01 1 mg $210 cart inquire
MUM - 1 (261 - 269)
EEKLIVVLF
10580-01 1 mg $220 cart inquire
MycC Peptide
YEQLRNSRA
10545-01 1 mg $205 cart inquire
MZ2 - F
YRPRPRRY
10608-01 1 mg $210 cart inquire
NES Adenoviral E1A
VMLAVQEGIDL
10660-01 1 mg $230 cart inquire
NES Nmd3p (491-500)
INIDELLDEL
10662-01 1 mg $210 cart inquire
NES p120ctn
CSLEEELDVLVLDDEGG
10658-01 1 mg $235 cart inquire
NES Topoisomerase II alpha (1054-1066)
FILEKIDGKIIIE
10664-01 1 mg $215 cart inquire
Nuclear Factor (Erythroid - derived 2)like 2 (74 - 87); Nrf2 (74 - 87); NFE2L2 (74 - 87)
LQLDEETGEFLPIQ
14312-05 5 mg $275 cart inquire
Noxa A BH3 peptide cell permeable
rrrrrrrrGAELPPEFAAQLRKIGDKVYC
14311-01 1 mg $298 cart inquire
Noxa BH3, Peptide 1-10698-01
PAELEVECATQLRRFGDKLNFRQKLL
10698-01 1 mg $315 cart inquire
NuBCP-9 A
FSRSLHSLL
10706-01 1 mg $210 cart inquire
Nuclear Export Signal, NES HIV Rev
LQLPPLERLTLD
10663-01 1 mg $210 cart inquire
Nuclear Export Signal, NES MAPKK
ALQKKLEELELD
10661-01 1 mg $210 cart inquire
Nuclear Export Signal, NES p53
FRELNEALELKD
10659-01 1 mg $210 cart inquire
NY-ESO-1 (87-111)
LLEFYLAMPFATPMEAELARRSLAQ
10731-01 1 mg $315 cart inquire
ORF5 fragment
PASKKTDPQK
10601-01 1 mg $220 cart inquire
p53 (12 - 20)
PPLSQETFS
10585-01 1 mg $220 cart inquire
p53, (12 - 26)
PPLSQETFSDLWKLL
10584-01 1 mg $235 cart inquire
p53 (17 - 26)
ETFSDLWKLL
10586-01 1 mg $120 cart inquire
p53 (17-26) FITC labeled
FITC-LC-ETFSDLWKLL-CONH2
10710-01 1 mg $220 cart inquire
p53 Mutant Form (361-371), Pab 421
KKGQSTSRHKK-CONH2
10676-01 1 mg $205 cart inquire
p53 Tumor Suppressor (361-393), human
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
10727-01 1 mg $380 cart inquire
PRAME epitope (PRA300 - 309) Tumor - associated an
ALYVDSLFFL
10547-01 1 mg $265 cart inquire
Prostate - Specific Antigen, PSA propeptide
APLILSR
10549-01 1 mg $250 cart inquire
Pro - TGF - α
HADLLAVVAASQ
10546-01 1 mg $320 cart inquire
PSA1(141 - 150)
FLTPKKLQCV
10598-01 1 mg $240 cart inquire
PSA2 (146–154)
KLQCVDLHV
10599-01 1 mg $220 cart inquire
Rab24 (179 - 199)
QVMTEDKGVDLSQKANPYFYS
10554-01 1 mg $295 cart inquire
RAGE derived peptide
SPSSNRIRNT
10600-01 1 mg $230 cart inquire
Shepherdin (79 - 87)
KHSSGCAFL
14313-01 1 mg $120 cart inquire
Stromal Target Antigen
SIYYYRYGL
10567-01 1 mg $230 cart inquire
STT Gelatinase Inhibitor modification, negative co
STTHWGFTLS
10669-01 1 mg $210 cart inquire
Survivin
ELTLGEFLKL
10592-01 1 mg $220 cart inquire
Survivin 2B (80–88)
AYACNTSTL
10732-01 1 mg $220 cart inquire
Telomerase Reverse Transcriptase p572Y (TERT572Y)
RLFFYRKSV
10711-01 1 mg $210 cart inquire
Thrombospondin - derived Peptide Cyclic CSVTCG
CSVTCG (S - S Bonded)
14314-01 1 mg $120 cart inquire
TP53 Q9NP68, p53 Mutant Form (361-377), Lys371 (Ac
KKGQSTSRHK-K(Ac)-LMFKTEG
10675-01 1 mg $240 cart inquire
TRP - 1, Fragment
MSLQRQFL
10610-01 1 mg $210 cart inquire
TRP - 2, Tyrosinase - related Protein 2 (181 - 188)
VYDFFVWL
14316-01 1 mg $120 cart inquire
TRP - 2 (180 - 188)
SVYDFFVWL
14315-01 1 mg $120 cart inquire
TRP - 2 coding region fragment
LLPGGRPYR
10609-01 1 mg $210 cart inquire
Tyrosinase (146 - 156)
SSDYVIPIGTY
10621-01 1 mg $230 cart inquire
Tyrosinase (192 - 200)
SEIWRDIDF
10623-01 1 mg $220 cart inquire
Tyrosinase (206 - 214), T9206
AFLPWHRLF
10622-01 1 mg $220 cart inquire
Tyrosinase (240 - 251)
DAEKCDICTDEY
10640-01 1 mg $260 cart inquire
Tyrosinase (240-251)
DAEKSDICTDEY
10734-01 1 mg $240 cart inquire
Tyrosinase(243 - 251),core nonamer sequence
KCDICTDEY
10629-01 1 mg $245 cart inquire
Tyrosinase (450 - 462)
SYLQDSDPDSFQD
10625-01 1 mg $260 cart inquire
Tyrosinase (56–70)
QNILLSNAPLGPQFP
10624-01