Live Chat Support Software
800.227.0627

Chemopreventive peptides are peptides that help prevent the onset or development of a disease such as cancer or diabetes. These peptides can either originate from natural sources, for example from soy or milk, from the design of peptide mimetics, or from peptide screens using synthetic peptides. It is thought that some of these peptides may function as modulators of the cell-cycle that regulates the production and function of proteins needed to advance cells through the replication cycle. In addition, there is now increased evidence that specific dietary pattern, foods and drinks, and other dietary substances can and do protect against cancer. More and more epidemiological studies suggest that food, nutrition and physical activity are important in the prevention and modification of the cancer process. Different types of food proteins and peptides that include plant protease inhibitors, lactoferrin, lactoferricin, lectins and lunasin appear to act as chemopreventive agents. Proteins and peptides are now considered as one group of nutraceuticals that show potential in preventing different stages of cancer including initiation, promotion and progression. Furthermore, some protease inhibitors found in plants such as legumes and soy beans have been found to be effective suppressors of carcinogenesis. Carcinogenesis is the process of initiating and promoting cancer. The Bowman-Birk inhibitor and the Kunitz trypsin inhibitors are among them. Presently the biological function of these compounds in carcinogenesis is mainly attributed to suppress invasion and metastasis of cancer cells, however, the mechanisms of action are still not fully known and further research is needed to fully elucidate them.

Bio-Synthesis offers wide selection of cancer research peptides. If you can’t find what you are looking for, we can provide our custom services. Our cancer research peptides are synthesized under stringent quality control with purity >95%. Large scale can be prepared through our custom synthesis services.

ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
234 CM - Cancer Research Peptides
KYICNSSCM
10582-01 1 mg $743 cart inquire
234 CW
KYMCNSSCM
10583-01 1 mg $743 cart inquire
[ - 2] pPSA, Prostate - Specific Antigen, truncate
SRIVGGWECEK
10559-01 1 mg $828 cart inquire
[ - 4]pPSA
ILSRIVGGWECEK
10561-01 1 mg $863 cart inquire
[A90,95] Bid BH3 (77 - 100), mouse
ESQEEIIHNIARHAAQIGAEMDHN
10701-01 1 mg $1,047 cart inquire
Adipophilin
SVASTITGV
10591-01 1 mg $743 cart inquire
AH1 Sequence (6 - 14)
SPSYVYHQF
14297-01 1 mg $405 cart inquire
[Ala6, Val15] MUC5AC Analog 2
GTTPSAVPTTSTTSVP
10570-01 1 mg $777 cart inquire
Amphoterin (150–183)
KLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKK
10568-01 1 mg $1,335 cart inquire
Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
10681-01 1 mg $1,283 cart inquire
anti - Flt1 peptide
GNQWFI
10581-01 1 mg $675 cart inquire
[APLILSR]pPSA
APLILSRIVGGWECEK
10560-01 1 mg $878 cart inquire
[Arg67]Bax H2-H3 (53-86), [R67] Helix 2-3 (53-86)
DASTKKLSECLKRIRDELDSNMELQRMIAAVDTD
10707-01 1 mg $1,335 cart inquire
(Asn370) Tyrosinase (368-376) Peptide
YMNGTMSQV
10605-01 1 mg $810 cart inquire
[Asp370] Tyrosinase (368 - 376) Peptide
YMDGTMSQV
10596-01 1 mg $405 cart inquire
Bad (103-127), human, all d-isomers
nlwaaqrygrelrrmsdefvdsfkk
10705-01 1 mg $1,250 cart inquire
BAD BH3 (103-123)
NLWAAQRYGRELRRMSDEFVD
10720-01 1 mg $998 cart inquire
BAD BH3 (146-159)
RYGRELRRMSDEFE
10714-01 1 mg $743 cart inquire
BAD Peptide, biotin-labeled
Biotin-LC-AGAGRSRHSSYPAGT
10688-01 1 mg $845 cart inquire
BAFF-R (160-183)
SVPVPATELGSTELVTTKTAGPEQ
10726-01 1 mg $1,047 cart inquire
BAGE (2 - 10)
AARAVFLAL
10630-01 1 mg $777 cart inquire
Bak - BH3
GQVGRQLAIIGDDINR
10646-01 1 mg $405 cart inquire
Bak BH3 (67-87)
PSSTMGQVGRQLAIIGDDINR
10722-01 1 mg $998 cart inquire
Bak-BH3 (69-93)
STMGQVGRQLAIIGDDINRRYDSEF
10690-01 1 mg $1,065 cart inquire
Bak BH3 (71-89)
MGQVGRQLAIIGDDINRRY
10680-01 1 mg $828 cart inquire
Bak-BH3 peptide, Mca labeled
7-methoxycoumarine-4-yl acetyl (Mca)-GQVGRQLAIIGDDINR
10668-01 1 mg $912 cart inquire
Bak-BH3 TAMRA-labeled
GQVGRQLAIIGDDINR-K(TAMRA)-CONH2
10473-01 0.1 mg $783 cart inquire
Bax I
PQDASTKKLSECLKRIGDELDSNMEL
10687-01 1 mg $1,065 cart inquire
Bax - BH3
KKLSECLKRIGDELDS
10647-01 1 mg $777 cart inquire
Bax BH3 (58-71)
KLSECLKRIGDELD
10717-01 1 mg $743 cart inquire
Bax - BH3L63A
KKLSECAKRIGDELDS
10648-01 1 mg $777 cart inquire
Bax BH3 peptide (55-74), wild type
STKKLSECLKRIGDELDSNM
10685-01 1 mg $845 cart inquire
Bax H2-H3 (53-86), Helix 2-3
DASTKKLSECLKRIGDELDSNMELQRMIAAVDTD
10699-01 1 mg $1,317 cart inquire
Bax H3 (71-86), Helix 3 (71-86)
DSNMELQRMIAAVDTD
10724-01 1 mg $810 cart inquire
Bcl-2 BH3 (85-105)
ALSPVPVVHLTLRQAGDFSRR
10723-01 1 mg $998 cart inquire
Bcl-2 BH3 Peptide II
LSPVPPVVHLALRQAGDDFSRRYRG
10691-01 1 mg $1,065 cart inquire
Bcl - 2 Binding Peptide Bad BH3 Peptide
LWAAQRYGRELRRMSDEFEGSFKGL
14298-01 1 mg $653 cart inquire
Bcl 9-2 (10692-005)
GSEGLSKEQLEHRERSLQTLRDIERLLLRSGETEPFLKGPPGGAG-CONH2
10692-005 0.5 mg $1,115 cart inquire
Bcl9-2, mutant
GSEGLSKEQLEHRERSFQTLRDIERLLLRSGETEPFLKGPPGGAG-CONH2
10693-005 0.5 mg $1,047 cart inquire
Bcl-XL BH3 (85-98)
AVKQALREAGDEFE
10713-01 1 mg $761 cart inquire
BDC2.5(A)
GKKVAAPAWARMG
10643-01 1 mg $761 cart inquire
BH3 BIM Peptide (52-71), human-10712-01
Ac-MRPEIWIAQELRRIGDEFNA
10712-01 1 mg $845 cart inquire
Bid - BH3
RNIARHLAQVGDSMDR
10649-01 1 mg $777 cart inquire
Bid BH3 (77-100), mouse
ESQEEIIHNIARHLAQIGDEMDHN
10700-01 1 mg $1,047 cart inquire
Bid BH3 (79-99)
QEDIIRNIARHLAQVGDSMDR
10719-01 1 mg $998 cart inquire
Bid BH3 (85-98)
NIARHLAQVGDSMD
10716-01 1 mg $743 cart inquire
Bid BH3, FAM labeled
5-FAM-EDIIRNIARHLAQVGDSMDR
10654-01 1 mg $1,350 cart inquire
Bid BH3 Peptide
EDIIRNIARHLAQVGDSMDR
10653-01 1 mg $392 cart inquire
Bid BH3, Peptide II, TAMRA labeled
5-TAMRA-EDIIRNIARHLAQVGDSMDR
10694-01 1 mg $1,182 cart inquire
Bid BH3 - r8
rrrrrrrr - GEDIIRNIARHLAQVGDSMDR
14299-005 0.5 mg $1,209 cart inquire
Bid BH3-R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
10671-01 1 mg $1,148 cart inquire
Bid BH3 - R9
RRRRRRRRRGEDIIRNIARHLAQVGDSMDR
10655-01 1 mg $1,148 cart inquire
Bik BH3 (50-70)
CMEGSDALALRLACIGDEMDV
10721-01 1 mg $998 cart inquire
Bik BH3 (56-69)
ALALRLACIGDEMD
10718-01 1 mg $743 cart inquire
Bim BH3 (87-100)
WIAQELRRIGDEFN
10715-01 1 mg $743 cart inquire
Bim BH3, Fragment II, TAMRA labeled
5-TAMRA-MRPEIWIAQELRRIGDEFNA
10684-005 0.5 mg $1,013 cart inquire
Bim BH3 Fragment I, TAMRA labeled
5-TAMRA-DNRPEIWIAQELRRIGDEFNAYYAR
10683-005 0.5 mg $1,047 cart inquire
Bim BH3, Peptide III
DMRPEIWIAQELRRIGDEFNAYYAR
10695-01 1 mg $653 cart inquire
Bim BH3, Peptide IV
DMRPEIWIAQELRRIGDEFNAYYARR
10696-01 1 mg $669 cart inquire
BMf-BH3
LQHRAEVQIARKLQCIADQFHRLHT
10697-01 1 mg $1,065 cart inquire
BRCAA1 (610-619)
SSKKQKRSHK
10728-01 1 mg $728 cart inquire
[C92,96] Bid BH3 (77-100), mouse
ESQEEIIHNIARHLACIGDCMDHN
10702-01 1 mg $1,047 cart inquire
Lunasin Peptide
NH2-SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD-COOH
14253-001 1 mgs $1,520 cart inquire
CEA, CAP - 1 - 6 - D, [Asp6] - Carcinoembryonic An
YLSGADLNL
10553-01 1 mg $810 cart inquire
CEA Related, QYSWFVNGTF
QYSWFVNGTF
10556-01 1 mg $710 cart inquire
CEA Related, TYACFVSNL
TYACFVSNL
10555-01 1 mg $810 cart inquire
c - Myc peptide epitope
EQKLISEEDL
10544-01 1 mg $405 cart inquire
Cripto - 1, CR - 1
CPPSFYGRNCEHDVRKE
10551-01 1 mg $963 cart inquire
[Cys92]Bid BH3 (77-100), mouse
ESQEEIIHNIARHLACIGDEMDHN
10703-01 1 mg $1,047 cart inquire
[Cys96]Bid BH3, mouse
ESQEEIIHNIARHLAQIGDCMDHN
10704-01 1 mg $1,047 cart inquire
[Cys(Acm)33]-Endostatin (6-49)
FQPVLHLVALNSPLSGGMRGIRGADFQ-C(Acm)-FQQARAVGLAGTFRAF
10657-005 0.5 mg $1,133 cart inquire
E75, Her - 2/neu (369 - 377)
KIFGSLAFL
10594-01 1 mg $743 cart inquire
EGFR (662-681)
RRELVEPLTPSGEAPNQALLR
10667-01 1 mg $998 cart inquire
Enhanced Green Fluorescent Protein, EGFP (200 - 208)
HYLSTQSAL
14300-01 1 mg $405 cart inquire
Ep - CAM (263 - 271)
GLKAGVIAV
10558-01 1 mg $743 cart inquire
G154, gp100 (154-162)
KTWGQYWQV
10562-01 1 mg $878 cart inquire
G209-2M, gp100 (209-217)
IMDQVPFSV
10564-01 1 mg $405 cart inquire
G209, gp100 (209-217)
ITDQVPFSV
10563-01 1 mg $810 cart inquire
G280-9, gp100 (280-288), Lys (biotin)
YLEPGPVTA-K(Biotin)
10566-01 1 mg $810 cart inquire
G280-9V, gp100(280-288) Lys(biotin)
YLEPGPVTV-K(Biotin)
10565-01 1 mg $810 cart inquire
GAD65 (78–97)
KPCNCPKGDVNYAFLHATDL
10641-01 1 mg $912 cart inquire
[Gln340]-Maspin, Reactive Site Loop (RSL), (330-34
GGDSIEVPGAQILQHK
10729-01 1 mg $777 cart inquire
GnT - V (nt38 - 67)
VLPDVFIRCV
10607-01 1 mg $777 cart inquire
gp100 (177–186)
AMLGTHTMEV
10633-01 1 mg $828 cart inquire
gp100 (178 - 187)
MLGTHTMEV
10617-01 1 mg $777 cart inquire
gp100 (25–33), human
KVPRNQDWL
10730-01 1 mg $405 cart inquire
gp100 (457 - 466)
LLDGTATLRL
10604-01 1 mg $728 cart inquire
gp100 (476 - 485)
VLYRYGSFSV
10616-01 1 mg $777 cart inquire
gp100 (570–579)
SLADTNSLAV
10615-01 1 mg $777 cart inquire
gp100 (614–622)
LIYRRRLMK
10612-01 1 mg $710 cart inquire
gp100 (619–627)
RLMKQDFSV
10614-01 1 mg $710 cart inquire
gp100 (639–647)
RLPRIFCSC
10613-01 1 mg $777 cart inquire
GPC3 (144 - 152)
FVGEFFTDV
10602-01 1 mg $743 cart inquire
GPC3 (298 - 306), mouse
EYILSLEEL
10603-01 1 mg $777 cart inquire
GRP78 Binding Chimeric Peptide Motif (10679-01)
WIFPWIQL-GG- klaklakklaklak-CONH2
10679-01 1 mg $1,047 cart inquire
HB-1 (26-41)
EDDVYLRHSSSLTYRL
10725-01 1 mg $777 cart inquire
HER - 2/Neu (654 - 662), GP2
IISAVVGIL
10557-01 1 mg $743 cart inquire
HIF - 1 {alpha} (556 - 574)
DLDLEMLAPYIPMDDDFQL
10644-01 1 mg $413 cart inquire
HIF - 2 (66 - 84)
SLEAQGIKADRETVAVKPT
10645-01 1 mg $828 cart inquire
Human PD - L1 inhibitor I  NEW
14301-01 1 mg $507 cart inquire
Human PD - L1 inhibitor II  NEW
14302-01 1 mg $507 cart inquire
Human PD - L1 inhibitor III  NEW
14303-01 1 mg $507 cart inquire
Human PD - L1 inhibitor IV  NEW
14304-01 1 mg $626 cart inquire
Human PD - L1 inhibitor V  NEW
14305-01 1 mg $405 cart inquire
IL-11R-alpha Binding Peptide II
CGRRAGGSC (S-S bonded)
10678-01 1 mg $845 cart inquire
[Ile12, Val15] MUC5AC Analog 3
GTTPSPVPTTSITSVP
10571-01 1 mg $777 cart inquire
[Ile161]MAGE-A2 (157-166)
YLQLIFGIEV
10632-01 1 mg $828 cart inquire
iLRP1, iLRP, Immature Laminin Receptor Protein (58-66)
LLLAARAIV
13696-01 1 mg $390 cart inquire
iLRP2, iLRP (60 - 68)
LAARAIVAI
10651-01 1 mg $710 cart inquire
iLRP3, iLRP(146 - 154 )
ALCNTDSPL
13697-01 1 mg $473 cart inquire
iLRP4, iLRP(7-15)
VLQMKEEDV
13700-01 1 mg $375 cart inquire
IP3 peptide, Acetylated and Biotinylated
Ac-MPRFMDYWEGLNK-K(Biotin)
10590-01 1 mg $912 cart inquire
IP3 peptide, (Lys)TAMRA labeled
MPRFMDYWEGLN-K(5/6-TMR)
10589-01 1 mg $1,115 cart inquire
IP3 Truncated Peptide, Acetylated
Ac-FMDYWEGLN
10588-01 1 mg $710 cart inquire
Kisspeptin - 10 (Kp - 10) Metastin (110 - 119), amide, mouse, rat
YNWNSFGLRY - NH2
14306-01 1 mg $405 cart inquire
Kisspeptin - 10 (Kp - 10) Metastin (45 - 54)
YNWNSFGLRF
14307-01 1 mg $405 cart inquire
KM - HN - 1(107 - 116)
VFGTRIEKDL
10636-01 1 mg $743 cart inquire
KM - HN - 1(196 - 204)
NYNNFYRFL
10634-01 1 mg $710 cart inquire
KM - HN - 1(335 - 343)
HFCRKCKKL
10637-01 1 mg $828 cart inquire
KM - HN - 1(499 - 508)
EYSKECLKEF
10638-01 1 mg $828 cart inquire
KM - HN - 1(65 - 74)
SFQALRMQTL
10635-01 1 mg $761 cart inquire
KM - HN - 1(770 - 778)
EYLSLSDKI
10639-01 1 mg $743 cart inquire
Laminin Peptide
CDPGYIGSR-amide
13694-01 1 mg $375 cart inquire
Livin7, ML - IAP
KWFPSCQFLL
10595-01 1 mg $810 cart inquire
LyP-1, Peptide 2
CGNKRTRGC
10677-01 1 mg $392 cart inquire
MAGE - 1 (161 - 169)
EADPTGHSY
10606-01 1 mg $777 cart inquire
MAGE - 1 (230–238 )
STAPPAHGV
10578-01 1 mg $743 cart inquire
MAGE3 (112 - 120)
KVAELVHFL
10620-01 1 mg $743 cart inquire
MAGE-3 (161-169)
EVDPIGHLY
10576-01 1 mg $743 cart inquire
MAGE - 3 (271 - 279)
FLWGPRALV
10577-01 1 mg $405 cart inquire
MAGE - A1 (237 - 245)
KLLTQDLVQ
10618-01 1 mg $743 cart inquire
MAGE-A 1(96–104)
SLFRAVITK
10733-01 1 mg $710 cart inquire
MAGE-A1 Antigen (278-286); human
KVLEYVIKV
10709-01 1 mg $710 cart inquire
MAGE - A2 (112 - 120)
KMVELVHFL
10619-01 1 mg $743 cart inquire
MAGE - A2 (157 - 166)
YLQLVFGIEV
10631-01 1 mg $810 cart inquire
MAGE - A3 (167 - 176)
MEVDPIGHLY
10627-01 1 mg $810 cart inquire
MAGE - A3 (195 - 203)
IMPKAGLLI
10628-01 1 mg $710 cart inquire
MAGE-A4 Antigen (230-239), human
GVYDGREHTV
10708-01 1 mg $728 cart inquire
MAGE - C2 (336–344)
ALKDVEERV
10597-01 1 mg $743 cart inquire
Melan - A/MART - 1 (24 - 34)
AEEAAGIGILT
10611-01 1 mg $777 cart inquire
Melanosomal Antigen II
DAEKCDKTDEY
10626-01 1 mg $828 cart inquire
MUC1 mucin core
GVTSAPDTRPAPGSTA
10548-01 1 mg $431 cart inquire
MUC1, tandem repeat fragment
PDTRPAPGSTAPPAHGVTSA
10593-01 1 mg $392 cart inquire
MUC5AC, Analog 1
GTTPSPVPTTSTTSAP
10569-01 1 mg $405 cart inquire
MUC5AC, Analog B
TTSTTSAPTTS
10575-01 1 mg $710 cart inquire
MUM - 1 (261 - 269)
EEKLIVVLF
10580-01 1 mg $743 cart inquire
MycC Peptide
YEQLRNSRA
10545-01 1 mg $693 cart inquire
MZ2 - F
YRPRPRRY
10608-01 1 mg $710 cart inquire
NES Adenoviral E1A
VMLAVQEGIDL
10660-01 1 mg $777 cart inquire
NES Nmd3p (491-500)
INIDELLDEL
10662-01 1 mg $710 cart inquire
NES p120ctn
CSLEEELDVLVLDDEGG
10658-01 1 mg $795 cart inquire
NES Topoisomerase II alpha (1054-1066)
FILEKIDGKIIIE
10664-01 1 mg $728 cart inquire
Nuclear Factor (Erythroid - derived 2)like 2 (74 - 87); Nrf2 (74 - 87); NFE2L2 (74 - 87)
LQLDEETGEFLPIQ
14312-01 1 mg $930 cart inquire
Noxa A BH3 peptide cell permeable
rrrrrrrrGAELPPEFAAQLRKIGDKVYC
14311-01 1 mg $1,007 cart inquire
Noxa BH3, Peptide 1-10698-01
PAELEVECATQLRRFGDKLNFRQKLL
10698-01 1 mg $1,065 cart inquire
NuBCP-9 A
FSRSLHSLL
10706-01 1 mg $710 cart inquire
Nuclear Export Signal, NES HIV Rev
LQLPPLERLTLD
10663-01 1 mg $710 cart inquire
Nuclear Export Signal, NES MAPKK
ALQKKLEELELD
10661-01 1 mg $710 cart inquire
Nuclear Export Signal, NES p53
FRELNEALELKD
10659-01 1 mg $710 cart inquire
ORF5 fragment
PASKKTDPQK
10601-01 1 mg $743 cart inquire
p53 (12 - 20)
PPLSQETFS
10585-01 1 mg $743 cart inquire
p53, (12 - 26)
PPLSQETFSDLWKLL
10584-01 1 mg $795 cart inquire
p53 (17 - 26)
ETFSDLWKLL
10586-01 1 mg $405 cart inquire
p53 (17-26) FITC labeled
FITC-LC-ETFSDLWKLL-CONH2
10710-01 1 mg $743 cart inquire
p53 Mutant Form (361-371), Pab 421
KKGQSTSRHKK-CONH2
10676-01 1 mg $693 cart inquire
p53 Tumor Suppressor (361-393), human
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
10727-01 1 mg $1,283 cart inquire
PRAME epitope (PRA300 - 309) Tumor - associated an
ALYVDSLFFL
10547-01 1 mg $896 cart inquire
Prostate - Specific Antigen, PSA propeptide
APLILSR
10549-01 1 mg $845 cart inquire
Pro - TGF - α
HADLLAVVAASQ
10546-01 1 mg $1,080 cart inquire
PSA1(141 - 150)
FLTPKKLQCV
10598-01 1 mg $810 cart inquire
PSA2 (146–154)
KLQCVDLHV
10599-01 1 mg $743 cart inquire
Rab24 (179 - 199)
QVMTEDKGVDLSQKANPYFYS
10554-01 1 mg $998 cart inquire
RAGE derived peptide
SPSSNRIRNT
10600-01 1 mg $777 cart inquire
Shepherdin (79 - 87)
KHSSGCAFL
14313-01 1 mg $405 cart inquire
Stromal Target Antigen
SIYYYRYGL
10567-01 1 mg $777 cart inquire
Survivin
ELTLGEFLKL
10592-01 1 mg $743 cart inquire
Survivin 2B (80–88)
AYACNTSTL
10732-01 1 mg $743 cart inquire
Telomerase Reverse Transcriptase p572Y (TERT572Y)
RLFFYRKSV
10711-01 1 mg $710 cart inquire
Thrombospondin - derived Peptide Cyclic CSVTCG
CSVTCG (S - S Bonded)
14314-01 1 mg $405 cart inquire
TP53 Q9NP68, p53 Mutant Form (361-377), Lys371 (Ac
KKGQSTSRHK-K(Ac)-LMFKTEG
10675-01 1 mg $810 cart inquire
TRP - 1, Fragment
MSLQRQFL
10610-01 1 mg $710 cart inquire
TRP - 2, Tyrosinase - related Protein 2 (181 - 188)
VYDFFVWL
14316-01 1 mg $405 cart inquire
TRP - 2 (180 - 188)
SVYDFFVWL
14315-01 1 mg $405 cart inquire
TRP - 2 coding region fragment
LLPGGRPYR
10609-01 1 mg $710 cart inquire
Tyrosinase (146 - 156)
SSDYVIPIGTY
10621-01 1 mg $777 cart inquire
Tyrosinase (192 - 200)
SEIWRDIDF
10623-01 1 mg $743 cart inquire
Tyrosinase (206 - 214), T9206
AFLPWHRLF
10622-01 1 mg $743 cart inquire
Tyrosinase (240 - 251)
DAEKCDICTDEY
10640-01 1 mg $878 cart inquire
Tyrosinase (240-251)
DAEKSDICTDEY
10734-01 1 mg $810 cart inquire
Tyrosinase(243 - 251),core nonamer sequence
KCDICTDEY
10629-01 1 mg $828 cart inquire
Tyrosinase (450 - 462)
SYLQDSDPDSFQD
10625-01 1 mg $878 cart inquire
Tyrosinase (56–70)
QNILLSNAPLGPQFP
10624-01 1 mg $828 cart inquire
VEGFR2/KDR Antagonist
ATWLPPR
10550-01 1 mg $413 cart inquire
VEGFR-2/KDR II, murine
VILTNPISM
10673-01 1 mg $743 cart inquire
VEGFR-2/KDR I, murine
FSNSTNDILI
10672-01 1 mg $743 cart inquire

Biosynthesis Inc.