Live Chat Support Software
800.227.0627

Beta Amyloid Peptides for Alzheimer's Diseases

As neurodegenerative diseases have become more common in aging population, finding tgreatments or cures has become a major focus of reseaerchers worldwide.  These disease affect the central nervous system and are chareacterized by loss of specific neuronal populations, and quite often intraneuronal, as well as extracellular accumulation of fibrillary materials. Most neurodegenerative diseases of the brain such as Alzheimer’s disease are caused by accumulation of protein in brain. In an Alzheimer’s patient’s brain, amyloid beta peptide (Aβ) aggregates to form amyloid plaques while tau protein aggregates to form neurofibrillary tangles in the neurons. These two components have been the center of studies involving pathological pathway in neurodegenerative diseases including Alzheimer and Parkinson disease.1

Amyloid beta peptides

Amyloid beta peptides are derived from proteolytic processing of amyloid precursor protein (APP) by β and γ secretases. This post translation modification results in Aβ (1-42) and (1-40), the most studied fragments of β-amyloid peptides.2 Aβ(1-42) fragment has been proposed the form amyloid senile plaques while the soluble A(1-40) primarily forms fibrils.3

In order to understand the mechanism of plaque formation, solution structure of Aβ(1-42) using NMR studies have been elucidated and have shown that the N-terminus residues 1 -10 are unstructured while residues 11-42 form β-strand-turn-β-strand structure (Figure 1B).5  Both Aβ(1-42) and Aβ(1-40) have been shown to form similar beta strand-turn-beta strand structure.6-7

Tau Proteins

Tau is a highly unstructured and soluble microtubule-associated protein. Its function in the brain is to regulate microtubule dynamics, axonal transport and neurite outgrowth in neurons.8 In Alzheimer patients, Tau protein is abnormally phosphorylated, this observation strongly suggested the key role of tau in neurofibrillary tangles formation, a condition associated with many neurodegenerative diseases.9-10 Other post translational modification found in tau protein of an Alzheimer patient include; glycation, transglutamylation and caspase cleavage.11 Tau, a 441 amino acid residues protein has 40 serine and threonine residues which are possible phosphorylation sites. Although this hyperphosphorylation is found in the brain of Alzheimer patients, not all the phosphorylated sites are associated with the disease since phosphorylated tau protein has been isolated in healthy brain. Despite the extensive research done on neurofibrillary tangles formed by phosphorylate tau protein, limited information is available regarding the specific phosphorylation site relevant neurodegenerative disease. Anti-tau antibodies raised against phosphorylated tau protein epitopes, have been utilized in immunodiagnostics of tau neurofibrillary tangles.12 As such, researchers have indicated that Tau immunotherapy can be a good target for Alzheimer disease therapy as well as Taupathie.β

References:

  1. Suh Y-H., and Checler F. Pharmacol. Rev., 2002, 54, 469-525
  2. Ahmed et al., Nat. Struct. & Mol. Biol. 2009, 17, 561-567
  3. Luhr et al., PNAS 2005 ,102, 17342-17347
  4. Olofsson et al., J. Biol Chem. 2006 281, 477-483
  5. Paravastua et al., PNAS 2008 ,105 18349-18354
  6. Marshall and Serpell, The Open Biology Journal, 2009, 2, 185-192
  7. Schmidt et al., PNAS 2009, 106, 19813-19818
  8. Chambraud et al., PNAS 2010 ,107, 2658-2663
  9. Baumann et al., FEBS 1993,  417-424
  10. Rapoport et al., PNAS 2002, 99, 6364-6369
  11. Pickhardt et al., Current Alzheimer Research 2005, 2, 219-226
  12. Taniguchi et al., FEBS 2005,  1399-1404

ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
26 - O - acyl isoA beta (1 - 42)
DAEFRHDSGYEVHHQKLVFFAEDVGj(COO)SNKGAIIGLMVGGVVIA
10194-005 0.5 mg $495 cart inquire
5 - FAM - beta - Amyloid (1 - 40) - Lys(LC - bioti
5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-BIOTIN)-CONH2
10237-001 0.1 mg $445 cart inquire
5 - FAM - beta - Amyloid (1 - 42) - K(5 - FAM), amide
5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(5-FAM)-CONH2
13773-001 0.1 mg $403 cart inquire
Abeta - DIP (183 - 196)
AEIPEEHIPHQQIQ
13932-01 1 mg $193 cart inquire
AceAcetyl-(Pro18,Asp21)-Amyloid beta-Protein (17-21) amide
Ac-LPFFD-CONH2
10204-01 1 mg $205 cart inquire
Acetyl - beta - Amyloid (15 - 20)
Ac-QKLVFF
10149-01 1 mg $210 cart inquire
Acetyl - beta - Amyloid (20 - 29), amide
Ac-FAEDVGSNKG-CONH2
10153-01 1 mg $205 cart inquire
Acetyl - [Pro18, NMePhe19] beta - Amyloid (17 - 21)
Ac-LP-(NMe-F)-FD-CONH2
10186-01 1 mg $320 cart inquire
[Ac - Lys(Me)16, N - Me - Val18] - beta - Amyloid (16 - 20) - NH2
Ac-K(Me)-L-(N-Me-V)-FF-CONH2
13814-01 1 mg $232 cart inquire
Activity - Dependent Neurotrophic Factor, ADNF   N
SALLRSIPA
10227-01 1 mg $200 cart inquire
AGA - (C8R) HNG17, Humanin derivative
PAGASRLLLLTGEIDLP
10226-01 1 mg $235 cart inquire
[Ala10]- β - Amyloid (1 - 10)
DAEFRHDSGA-CONH2
10268-01 1 mg $210 cart inquire
[Ala16,17,20]-β-Amyloid (1-28)
DAEFRHDSGYEVHHQAAVFAAEDVGSNK
13721-01 1 mg $325 cart inquire
[Ala18] - beta - Amyloid (1 - 42); V18A beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLAFFAEDVGSNKGAIIGLMVGGVVIA
13786-01 1 mg $485 cart inquire
[Ala20]-β-Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFAAEDVGSNKGAIIGLMVGGVVIA
10287-005 0.5 mg $390 cart inquire
[Ala22] - beta - Amyloid (1 - 42); E22A beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFAADVGSNKGAIIGLMVGGVVIA
13788-01 1 mg $485 cart inquire
[Ala23] - beta - Amyloid (1 - 42); D23A beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFAEAVGSNKGAIIGLMVGGVVIA
13789-01 1 mg $485 cart inquire
[Ala25] - beta - Amyloid (1 - 42); G25A beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFAEDVASNKGAIIGLMVGGVVIA
13778-01 1 mg $485 cart inquire
[Ala27] - beta - Amyloid (1 - 42); N27A beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFAEDVGSAKGAIIGLMVGGVVIA
13787-01 1 mg $485 cart inquire
[Ala28]-β-Amyloid (1 - 40)
DAEFRHDSGYEVHHQALVFFAEDVGSNAGAIIGLMVGGVV
10243-005 0.5 mg $500 cart inquire
[Ala28]-beta-Amyloid (1-42); K28A beta-Amyloid (1-42)
DAEFRHDSGYEVHHQKLVFFAEDVGSNAGAIIGLMVGGVVIA
13779-01 1 mg $485 cart inquire
[Ala29] - beta - Amyloid (1 - 42); G29A beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKAAIIGLMVGGVVIA
13783-01 1 mg $485 cart inquire
[Ala31] - beta - Amyloid (1 - 42); I31A beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAAIGLMVGGVVIA
13777-01 1 mg $485 cart inquire
[Ala34]-β-Amyloid (1 - 34)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGA
10274-01 1 mg $395 cart inquire
[Ala37] - b - Amyloid (1 - 40); G37A b - Amyloid (1 - 40)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVAGVV
13739-01 1 mg $350 cart inquire
[Ala37] - beta - Amyloid (1 - 42); G37A beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVAGVVIA
13790-01 1 mg $485 cart inquire
[Ala38] - beta - Amyloid (1 - 40); G38A beta - Amyloid (1 - 40)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGAVV
13740-01 1 mg $375 cart inquire
[Ala8] - Humanin, [Ala8] - HN, sHNA
MAPRGFSALLLLTSEIDLPVKRRA
10191-01 1 mg $215 cart inquire
Amylin(20 - 29), Islet Amyloid Polypeptide, IAPP (20 - 29), cat
SNNFGAILSP
13724-01 1 mg $177 cart inquire
Amylin(20 - 29), Islet Amyloid Polypeptide, IAPP (20 - 29), hamster
NNNLGPVLSP
13725-01 1 mg $177 cart inquire
Amylin(20 - 29), Islet Amyloid Polypeptide, IAPP (20 - 29), rat
SNNLGPVLPP
13726-01 1 mg $177 cart inquire
Amyloid - Forming Peptide GNNQQNY
GNNQQNY
13933-01 1 mg $120 cart inquire
Amyloid Precursor - Like Protein 1, APLP1 (594 - 610)
GGGSLIVLSLLLLRKKK
13917-01 1 mg $210 cart inquire
Amyloid Precursor - Like Protein 2, APLP2 (706 - 721)
AIATVIVISLVMLRKR
13918-01 1 mg $199 cart inquire
Amyloid Precursor Protein (APP) (44 - 62)
HMNVQNGKWDSDPSGTKTC
10255-01 1 mg $300 cart inquire
Amyloid Precursor Protein (APP) (667 - 676)
SEVKMDAEFR
10263-01 1 mg $200 cart inquire
Amyloid Precursor Protein (APP) (667 - 676), Dnp - labeled
SEVKMDAEFR-DAP(DNP)-KK
10265-01 1 mg $430 cart inquire
Amyloid Precursor Protein, (APP) (667 - 676), FRET
Mca-SEVKMDAEFR-Dap(Dnp)-CONH2
10266-01 1 mg $460 cart inquire
Amyloid Precursor Protein (APP) (667 - 676), Swedi
SEVNLDAEFR
10262-01 1 mg $200 cart inquire
Amyloid Precursor Protein, (APP) (721 - 770)
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
13916-005 0.5 mg $457 cart inquire
Amyloid Precursor Protein (APP) (741 - 770)
AVTPEERHLSKMQQNGYENPTYKFFEQMQN
13915-01 1 mg $381 cart inquire
Amyloid Toxicity Inhibitor Peptide 11
RGTFEGKF-CONH2
13910-01 1 mg $171 cart inquire
Amyloid Toxicity Inhibitor Peptide 110
RGTWEGKW-CONH2
13911-01 1 mg $171 cart inquire
Amyloid Toxicity Inhibitor Peptide 111
RGTYEGKY-CONH2
13912-01 1 mg $171 cart inquire
Amyloid Toxicity Inhibitor Peptide 13
RGTLEGKL-CONH2
13913-01 1 mg $171 cart inquire
Anti - Parallel Topology beta - Amyloid Modified Peptide II
CHQKLVFFAEDYNGKHQKLVFFAED
10222-01 1 mg $315 cart inquire
[Arg13] - beta - Amyloid (1 - 42); H13R beta - Amyloid (1 - 42)
DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
13791-01 1 mg $485 cart inquire
[Arg666, Glu667, Asn670, Leu671,Lys676, Arg677]
RE(EDANS)EVNLDAEFK(DABCYL)R
10279-005 0.5 mg $320 cart inquire
[Arg6]-beta-Amyloid (1-40), English Mutation, Human
DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
13741-01 1 mg $295 cart inquire
[Arg6] - beta - Amyloid (1 - 42), English Mutation, human
DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
13793-005 0.5 mg $260 cart inquire
[Asn23] - β- Amyloid (1 - 40), (D23N), Iowa Mutation (10275-005)
DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
10275-005 0.5 mg $215 cart inquire
[Asn23] - beta - amyloid (1 - 42), Iowa Mutation, human
DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
13794-005 0.5 mg $260 cart inquire
[Asn 6,13,14] -β- Amyloid (1 - 42)
DAEFRNDSGYEVNNQKLVFFAEDVGSNKGAIIGLMVGGVVIA
10235-001 0.1 mg $245 cart inquire
[Asn7]-beta-Amyloid (1-40), Tottori-Japanese Mutation
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
13742-01 1 mg $295 cart inquire
[Asn7] - beta - Amyloid (1 - 42), Tottori - Japanese Mutation
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
13795-005 0.5 mg $260 cart inquire
[Asp22] - beta - Amyloid (1 - 42); E22D beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFADDVGSNKGAIIGLMVGGVVIA
13782-01 1 mg $485 cart inquire
[Asp37] - beta - Amyloid (1 - 42)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVDGVVIA
13796-005 0.5 mg $391 cart inquire
Beta - Amyloid (10 - 19)
YEVHHQKLVF
13836-01 1 mg $177 cart inquire
β-Amyloid (10 - 20)
YEVHHQKLVFF
10123-01 1 mg $120 cart inquire
Beta - Amyloid (10 - 26)
YEVHHQKLVFFAEDVGS
13837-01 1 mg $120 cart inquire
β-Amyloid (10 - 35)
YEVHHQKLVFFAEDVGSNKGAIIGLM
10229-01 1 mg $300 cart inquire
Beta - Amyloid (10 - 35) - Lys(Biotin) - NH2
YEVHHQKLVFFAEDVGSNKGAIIGLM-K(Biotin)-CONH2
13838-001 0.1 mg $221 cart inquire
Beta - Amyloid (1 - 10)
DAEFRHDSGY
13819-01 1 $129 cart inquire
Beta - Amyloid (1 - 10) - Cys
DAEFRHDSGYC
13820-01 1 mg $183 cart inquire
Beta - Amyloid (1 - 10), mouse, rat
DAEFGHDSGF
13893-01 1 mg $193 cart inquire
β-Amyloid (1 - 11)
DAEFRHDSGYE
10078-01 1mg $120 cart inquire
Beta - Amyloid (11 - 17)
EVHHQKL
13839-01 1 mg $120 cart inquire
β-Amyloid (1 - 11) - Lys (Biotin)
DAEFRHDSGY-K(Biotin)
10271-01 1 mg $350 cart inquire
Beta - Amyloid (1 - 12)
DAEFRHDSGYEV
13821-01 1 mg $120 cart inquire
β-Amyloid (11 - 22)
EVHHQKLVFFAE
10100-01 1 mg $120 cart inquire
Beta - Amyloid (11 - 25)
EVHHQKLVFFAEDVG
13840-01 1 mg $120 cart inquire
β-Amyloid (11 - 28) - Lys (Biotin) - NH2
EVHHQKLVFFAEDVGSNK-K(Biotin)-CONH2
10300-005 0.5 mg $400 cart inquire
Beta - Amyloid (11 - 28), mouse, rat
EVRHQKLVFFAEDVGSNK
13905-01 1 mg $221 cart inquire
Beta - Amyloid (1 - 12) - Cys
DAEFRHDSGYEVC
13822-01 1 mg $171 cart inquire
Beta - Amyloid (1 - 12) - Cys - NH2
DAEFRHDSGYEVC-CONH2
13823-01 1 mg $171 cart inquire
Beta - Amyloid (1 - 12) - Lys(Biotin) - NH2
DAEFRHDSGYEV-K(Biotin)-CONH2
13824-01 1 mg $221 cart inquire
Beta - Amyloid (1 - 13)
DAEFRHDSGYEVH
13825-01 1 mg $120 cart inquire
Beta - Amyloid (1 - 13), mouse, rat
DAEFGHDSGFEVR
13894-01 1 mg $210 cart inquire
Beta - Amyloid (1 - 14)
DAEFRHDSGYEVHH
13826-01 1 mg $188 cart inquire
β-Amyloid (11 - 40)
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
10143-01 1 mg $380 cart inquire
Beta - Amyloid (11 - 40), FAM - labeled
5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
13766-001 0.1 mg $281 cart inquire
β-Amyloid (11 - 40) - Lys(biotin) - NH2
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-CONH2
10299-005 0.5 mg $500 cart inquire
Beta - Amyloid (11 - 40), mouse, rat
EVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
13906-01 1 mg $403 cart inquire
Beta - Amyloid (11 - 42), human
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
13804-01 1 mg $300 cart inquire
Beta - Amyloid (11 - 42), FAM - labeled
5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
13805-001 0.1 mg $281 cart inquire
Beta - Amyloid(11 - 42) - Lys(Biotin) - NH2
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-CONH2
13880-005 0.5 mg $584 cart inquire
β-Amyloid (1 - 15)
DAEFRHDSGYEVHHQ
10215-01 1 mg $120 cart inquire
Beta - Amyloid (1 - 15), biotin - labeled, amide
DAEFRHDSGYEVHHQ-K(biotin)-CONH2
13827-01 1 mg $232 cart inquire
β-Amyloid (1 - 16)
DAEFRHDSGYEVHHQK
10105-01 1 mg $120 cart inquire
Beta - Amyloid (1 - 16) - 8 branched MAPS
DAEFRHDSGYEVHHQK-on 8 branch MAPS
13828-01 1 mg $320 cart inquire
Beta - Amyloid (1 - 16) - Cys
DAEFRHDSGYEVHHQKC
13829-01 1 mg $210 cart inquire
β-Amyloid (1 - 16) - Lys(Biotin - LC) - NH2
DAEFRHDSGYEVHHQK-K(BIOTIN-LC)-CONH2
10296-01 1 mg $360 cart inquire
β-Amyloid (1 - 17)
DAEFRHDSGYEVHHQKL
10232-01 1 mg $120 cart inquire
Beta - Amyloid (1 - 17), FAM - labeled
5-FAM-DAEFRHDSGYEVHHQKL
13830-001 0.1 mg $215 cart inquire
Beta - Amyloid (1 - 17), mouse, rat
DAEFGHDSGFEVRHQKL
13895-01 1 mg $232 cart inquire
β-Amyloid (1 - 20)
DAEFRHDSGYEVHHQKLVFF
10293-01 1 mg $250 cart inquire
Beta - Amyloid (1 - 22)
DAEFRHDSGYEVHHQKLVFFAE
13831-01 1 mg $176 cart inquire
β-Amyloid (12 - 20)
VHHQKLVFF
10200-01 1 mg $200 cart inquire
Beta - Amyloid (12 - 22)
VHHQKLVFFAE
13841-01 1 mg $177 cart inquire
β - Amyloid (12 - 24)
VHHQKLVFFAEDV
13718-01 1 mg $120 cart inquire
β-Amyloid (12 - 28), Human
VHHQKLVFFAEDVGSNK
10107-01 1 mg $190 cart inquire
β-Amyloid (12 - 28) - Cys
VHHQKLVFFAEDVGSNKC
10096-01 1 mg $660 cart inquire
Beta - Amyloid (12 - 33), mouse, rat
VRHQKLVFFAEDVGSNKGAIIG
13907-01 1 mg $281 cart inquire
β-Amyloid (12 - 42)
VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
10290-01 1 mg $400 cart inquire
Beta - Amyloid (1 - 24) - Cys
DAEFRHDSGYEVHHQKLVFFAEDVC
13832-01 1 mg $281 cart inquire
β-Amyloid (1 - 28), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNK
10108-01 1 mg $180 cart inquire
β-Amyloid (1 - 28), AMCA - labeled
AMCA-DAEFRHDSGYEVHHQKLVFFAEDVGSNK
10169-001 0.1 mg $375 cart inquire
β-Amyloid (1 - 28), FAM - labeled
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNK
10187-005 0.5 mg $700 cart inquire
β-Amyloid (1 - 28) - Lys(Biotin)
DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)
10205-01 1 mg $350 cart inquire
Beta-Amyloid (1-28)-Lys(Biotin)-NH2
DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-CONH2
13734-01 1 mg $400 cart inquire
β-Amyloid (1 - 28) - Lys (Biotin) - NH2
DAEFRHDSGYEVHHQKLVFFAEDVGSNKK(Biotin)-CONH2
10297-005 0.5 mg $450 cart inquire
Beta - Amyloid (1 - 28), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNK
13896-01 1 mg $320 cart inquire
β-Amyloid (1 - 28), TAMRA - labeled
TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNK
10170-001 0.1 mg $415 cart inquire
Beta - Amyloid (13 - 22)
HHQKLVFFAE
13727-01 1 mg $177 cart inquire
β - Amyloid (13 - 23)
HHQKLVFFAED
13719-01 1 mg $120 cart inquire
β-Amyloid (13 - 28), Human
HHQKLVFFAEDVGSNK
10219-01 1 mg $120 cart inquire
β-Amyloid (1 - 33)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
10159-01 1 mg $408 cart inquire
β-Amyloid (1 - 34)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
10216-005 0.5 mg $171 cart inquire
β - Amyloid (13 - 40)
HHQKLVFFAEDVGSNKGAIIGLMVGGVV
13767-01 1 mg $325 cart inquire
Beta - Amyloid (1 - 34), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGL
13897-01 1 mg $447 cart inquire
β-Amyloid (1 - 36)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
10161-01 1 mg $500 cart inquire
β-Amyloid (1 - 37)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
10160-01 1 mg $418 cart inquire
β-Amyloid (1 - 38)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
10109-01 1 mg $375 cart inquire
Beta - Amyloid (1 - 38), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
13898-01 1 mg $418 cart inquire
β-Amyloid (1 - 39)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
10112-01 1 mg $330 cart inquire
Beta - Amyloid (1 - 39), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGV
13899-005 0.5 mg $293 cart inquire
β-Amyloid (1 - 40), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
10110-01 1 mg $215 cart inquire
β-Amyloid (1 - 40), AMCA - labeled
AMCA-X-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
10178-001 0.1 mg $395 cart inquire
β-Amyloid (1 - 40) Binding Peptide
DWGKGGRWRLWPGASGKTEA
10280-01 1 mg $250 cart inquire
β-Amyloid (1 - 40) Binding Peptide, Biotin - labeled
Biotin-DWGKGGRWRLWPGASGKTEA
10281-01 1 mg $182 cart inquire
Beta-Amyloid (1-40) Binding Peptide, FAM-labeled
5-FAM-DWGKGGRWRLWPGASGKTEA
13758-01 0.1 mg $215 cart inquire
Beta - Amyloid (1 - 40) - Cys, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
13764-001 0.1 mg $110 cart inquire
β-Amyloid (1 - 40), DAC - labeled
(7-Diethylaminocoumarin-3-yl)carbonyl-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
10231-001 0.1 mg $300 cart inquire
β-Amyloid (1 - 40), FAM - labeled
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
10084-001 0.1 mg $130 cart inquire