Live Chat Support Software
800.227.0627

Definition
Several viralpeptides are cytotoxic T lymphocytes (CTL) epitopes or H-2Db-restricted epitope, help in T cell receptor recognition process and there by clearance of virus-infected cells.

Discovery
Tsomides TJ et al., in 1994 have established an assay system based on several newly developed cell lines that stably and uniformly express HIV-1 and CTL obtained from HIV-seropositive individuals. They identified HIV peptides presented endogenously by MHC-I molecules 1. Such peptides can be extracted from virus-infected cells by acid elution. Both the naturally processed H–2-Db-restricted and H–2-Kd-restricted peptides from influenza nucleoprotein are smaller than the corresponding synthetic peptides, which have first been used to determine the respective CTL epitopes. As with minor histocompatibility antigens, occurrence of viral peptides seems to be heavily dependent on MHC class I molecules, because infected H–2d cells do not contain the H–2-Db-restricted peptide, and infected H–2b cells do not contain the H–2-Kd-restricted peptide. Data provide direct experimental proof for the above notion on MHC-associated viral peptides on virus-infected cells 2.

Structural Characteristics
The x-ray structures of a murine MHC class I molecule (H-2Kb) were determined in complex with two different viral peptides, derived from the vesicular stomatitis virus nucleoprotein, VSV-8, and the Sendai virus nucleoprotein, SEV-9. The H-2Kb complexes were refined at 2.3 Ǻ for VSV-8 and 2.5 Ǻ for SEV-9. The structure of H-2Kb exhibits a high degree of similarity with human HLA class I, although the individual domains can have slightly altered dispositions. Both peptides bind in extended conformations with most of their surfaces buried in the H-2Kb binding groove. The nanomer peptide maintains the same amino- and carboxyl-terminal interactions as the octamer primarily by the insertion of a bulge in the center of an otherwise beta conformation. Most of the specific interactions are between side-chain atoms of H-2Kb and main-chain atoms of peptide. This binding scheme accounts in large part for the enormous diversity of peptide sequences that bind with high affinity to class I molecules. Small but significant conformational changes in H-2Kb are associated with peptide binding, and these synergistic movements may be an integral part of the T cell receptor recognition process 3.

Mode of Action
MHC-restricted CTL play a central role in immune responses against many viruses by destroying virus infected cells. Unlike antibodies, CD8+ CTL recognize conserved sequences from intracellular viral proteins in addition to sequences from virus-encoded cell surface glycoproteins. Several viruses express genes that down-regulate expression of class I MHC proteins, thus providing them with a means of escape from cytotoxic T lymphocytes but rendering them susceptible to lysis by NK cells. The almost ubiquitous expression of class I MHC molecules provides one means by which NK cells discriminate among modified target cells that may have lost or down-regulated surface class I MHC molecule. The absence or dysregulation of class I MHC proteins may partially explain how NK cells survey tissue for the normal expression of class I MHC, the missing self hypothesis. Tumor cells down-regulate expression of class I MHC proteins, and those that express class I proteins are more resistant to killing by NK cells than derivatives that specifically lack class I MHC expression. Class I negative mutant cell lines sensitive to NK lysis can be rescued by transfection of appropriate class I MHC molecules 4,5.

Functions
Elimination of virus infected cell, virus-infected cells can be eliminated by CTL, which recognize virus-derived peptides bound to MHC class I molecules on the cell surface 2.

Natural killer (NK) cells are inhibited by specific allotypes of class I major histocompatibility complex ligands recognized by polymorphic inhibitory receptors (e.g., NKIR1 and NKIR2). NK1- and NK2-specific clones recognize two groups of HLA-C allotypes that are distinguished by a dimorphism at residue 80 in the α1 helix (αLys-80 and αAsn-80, respectively). Peptides derived from glutamic acid decarboxylase or coxsackie virus (each of which has been associated with autoimmune diabetes mellitus) abrogated this inhibitory recognition 6.

CD8 + CTL specific for diverse HIV products (e.g., gag, pol, nef, env) appear within 1-2 wk of infection, and the importance of these CTL is suggested by their unusually high frequencies: they can often be detected in freshly isolated PBMC without the in vitro antigenic stimulation usually required to demonstrate CTL activity in other viral infections  1.

References

  1. Tsomides TJ, Aldovini A, Johnson RP, Walker BD, Young RA, Eisen HN (1994). Naturally processed viral peptides recognized by cytotoxic T lymphocytes on cells chronically infected by human immunodeficiency virus type 1. J Exp Med., 180(4):1283-1293.
  2. Rötzschke O, Falk K, Deres K, Schild H, Norda M, Metzger J, Jung G, Rammensee HG (1990). Isolation and analysis of naturally processed viral peptides as recognized by cytotoxic T cells. Nature, 348(6298):252-254.
  3. Fremont DH, Matsumura M, Stura EA, Peterson PA, Wilson IA (1992). Crystal structures of two viral peptides in complex with murine MHC class I H-2Kb. Science, 257(5072):919-927.
  4. Ljunggren H-G, Karre K (1990). In search of the 'missing self': MHC molecules and NK cell recognition. Immunol Today., 11(7):237-244.
  5. Kärre K, Ljunggren HG, Piontek G, Kiessling R. (1986). Selective rejection of H-2-deficient lymphoma variants suggests alternative immune defence strategy. Nature, 319:675–678.
  6. Mandelboim O, Wilson SB, Valés-Gómez M, Reyburn HT, Strominger JL (1997). Self and viral peptides can initiate lysis by autologous natural killer cells. PNAS., 94(9):4604-4609.

ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
14224-01
CDKCEARQE-NH2
14224-01 1 mg $210 cart inquire
AD - 2S1, HCMV Glycoprotein B Epitope
Ac-KKSHRANETIYNTTLKYGDVTGTNTT-K(Biotin)-NH2
14015-01 1 mg $320 cart inquire
Adenovirus Early DNA - Binding Protein, E2A (412 - 420)
LPKLTPFAL
14016-01 1 mg $171 cart inquire
ADP 715, HIV - I, MN Strain
RKRIHIGPGRAFYTTKN
14017-01 1 mg $205 cart inquire
Apstatin, Aminopeptidase P Inhibitor 14018-01
N-[(2S,3R)-3-amino-2-hydroxy-4-phenylbutanoyl]-PPA-NH2
14018-01 1 mg $171 cart inquire
B8R (20 - 27)
TSYKFESV
14019-01 1 mg $120 cart inquire
BZLF1 (52 - 64), Epstein - Barr Virus
LPEPLPQGQLTAY
14020-01 1 mg $171 cart inquire
BZLF1 (54 - 64), Epstein - Barr Virus
EPLPQGQLTAY
14021-01 1 mg $161 cart inquire
C39 Peptide; Human Respiratory Syncytial Virus (hRSV) F Protein (482 - 520)
VFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGK
14022-01 N/A $535 cart inquire
CKS - 17 (dimer) MN10021
LQNRRGLDLLFLKEGGLC (dimer)
14023-01 1 mg $160 cart inquire
CMV Envelope Glycoprotein - B (217 - 227)
DYSNTHSTRYV
14024-01 1 mg $171 cart inquire
CMV EP 88, Cytomegalovirus Early Protein pp89 Derivative, YPHFMPTNL
YPHFMPTNL
14025-01 1 mg $171 cart inquire
CMVpp65 - 100 (DDVWTSGSDSDEELV)
DDVWTSGSDSDEELV
14030-01 1 mg $193 cart inquire
CMVpp65 - 101 (TSGSDSDEELVTTER)
TSGSDSDEELVTTER
14031-01 1 mg $193 cart inquire
CMVpp65 - 102 (DSDEELVTTERKTPR)
DSDEELVTTERKTPR
14032-01 1 mg $193 cart inquire
CMVpp65 - 103 (ELVTTERKTPRVTGG)
ELVTTERKTPRVTGG
14033-01 1 mg $193 cart inquire
CMVpp65 - 104 (TERKTPRVTGGGAMA)
TERKTPRVTGGGAMA
14034-01 1 mg $193 cart inquire
CMVpp65 - 106 (TGGGAMAGASTSAGR)
TGGGAMAGASTSAGR
14035-01 1mg $193 cart inquire
CMVpp65 - 107 (AMAGASTSAGRKRKS)
AMAGASTSAGRKRKS
14036-01 1 mg $193 cart inquire
CMVpp65 - 108 (ASTSAGRKRKSASSA)
ASTSAGRKRKSASSA
14037-01 1 mg $193 cart inquire
CMVpp65 - 109 (AGRKRKSASSATACT)
AGRKRKSASSATACT
14038-01 1 mg $193 cart inquire
CMVpp65 - 10 (HETRLLQTGIHVRVS)
HETRLLQTGIHVRVS
14029-01 1 mg $193 cart inquire
CMVpp65 - 110 (RKSASSATACTSGVM)
RKSASSATACTSGVM
14040-01 1 mg $193 cart inquire
CMVpp65 - 110 (RKSASSATACTSGVM)
RKSASSATACTSGVM
14041-01 1 mg $193 cart inquire
CMVpp65 - 111 (SSATACTSGVMTRGR)
SSATACTSGVMTRGR
140042-01 1 mg $193 cart inquire
CMVpp65 - 113 (GVMTRGRLKAESTVA)
GVMTRGRLKAESTVA
14043-01 1 mg $193 cart inquire
CMVpp65 - 114 (RGRLKAESTVAPEED)
RGRLKAESTVAPEED
14044-01 1 mg $193 cart inquire
CMVpp65 - 115 (KAESTVAPEEDTDED)
KAESTVAPEEDTDED
14045-01 1 mg $193 cart inquire
CMVpp65 - 116 (TVAPEEDTDEDSDNE)
TVAPEEDTDEDSDNE
14046-01 1 mg $193 cart inquire
CMVpp65 - 117 (EEDTDEDSDNEIHNP)
EEDTDEDSDNEIHNP
14047-01 1 mg $193 cart inquire
CMVpp65 - 118 (DEDSDNEIHNPAVFT)
DEDSDNEIHNPAVFT
14048-01 1 mg $193 cart inquire
CMVpp65 - 119 (DNEIHNPAVFTWPPW)
DNEIHNPAVFTWPPW
14049-01 1 mg $193 cart inquire
CMVpp65 - 11 (LLQTGIHVRVSQPSL)
LLQTGIHVRVSQPSL
14039-01 1 mg $193 cart inquire
CMVpp65 - 120 (HNPAVFTWPPWQAGI)
HNPAVFTWPPWQAGI
14055-01 1 mg $193 cart inquire
CMVpp65 - 121 (VFTWPPWQAGILARN)
VFTWPPWQAGILARN
14056-01 1 mg $193 cart inquire
CMVpp65 - 122 (PPWQAGILARNLVPM)
PPWQAGILARNLVPM
14057-01 1 mg $193 cart inquire
CMVpp65 - 123 (AGILARNLVPMVATV)
AGILARNLVPMVATV
14058-01 1 mg $193 cart inquire
CMVpp65 - 124 (ARNLVPMVATVQGQN)
ARNLVPMVATVQGQN
14059-01 1 mg $193 cart inquire
CMVpp65 - 125 (VPMVATVQGQNLKYQ)
VPMVATVQGQNLKYQ
14060-01 1 mg $193 cart inquire
CMVpp65 - 126 (ATVQGQNLKYQEFFW)
ATVQGQNLKYQEFFW
14061-01 1 mg $193 cart inquire
CMVpp65 - 127 (GQNLKYQEFFWDAND)
GQNLKYQEFFWDAND
14062-01 1 mg $193 cart inquire
CMVpp65 - 128 (KYQEFFWDANDIYRI)
KYQEFFWDANDIYRI
14063-01 1 mg $193 cart inquire
CMVpp65 - 129 (FFWDANDIYRIFAEL)
FFWDANDIYRIFAEL
14064-01 1 mg $193 cart inquire
CMVpp65 - 12 (GIHVRVSQPSLILVS)
GIHVRVSQPSLILVS
14050-01 1 mg $193 cart inquire
CMVpp65 - 130 (ANDIYRIFAELEGVW)
ANDIYRIFAELEGVW
14066-01 1 mg $193 cart inquire
CMVpp65 - 131 (YRIFAELEGVWQPAA)
YRIFAELEGVWQPAA
14067-01 1 mg $193 cart inquire
CMVpp65 - 132 (AELEGVWQPAAQPKR)
AELEGVWQPAAQPKR
14068-01 1 mg $193 cart inquire
CMVpp65 - 133 (GVWQPAAQPKRRRHR)
GVWQPAAQPKRRRHR
14069-01 1 mg $193 cart inquire
CMVpp65 - 134 (PAAQPKRRRHRQDAL)
PAAQPKRRRHRQDAL
14070-01 1 mg $193 cart inquire
CMVpp65 - 135 (PKRRRHRQDALPGPC)
PKRRRHRQDALPGPC
14071-01 1 mg $193 cart inquire
CMVpp65 - 136 (RHRQDALPGPCIAST)
RHRQDALPGPCIAST
14072-01 1 mg $193 cart inquire
CMVpp65 - 137 (DALPGPCIASTPKKH)
DALPGPCIASTPKKH
14073-01 1 mg $193 cart inquire
CMVpp65 - 138 (GPCIASTPKKHRG)
GPCIASTPKKHRG
14074-01 1 mg $193 cart inquire
CMVpp65 - 13 (RVSQPSLILVSQYTP)
RVSQPSLILVSQYTP
14065-01 1 mg $193 cart inquire
CMVpp65 - 14 (PSLILVSQYTPDSTP)
PSLILVSQYTPDSTP
14075-01 1 mg $193 cart inquire
CMVpp65 - 15 (LVSQYTPDSTPCHRG)
LVSQYTPDSTPCHRG
14076-01 1 mg $193 cart inquire
CMVpp65 - 16 (YTPDSTPCHRGDNQL)
YTPDSTPCHRGDNQL
14077-01 1 mg $193 cart inquire
CMVpp65 - 18 (HRGDNQLQVQHTYFT)
HRGDNQLQVQHTYFT
14078-01 1 mg $193 cart inquire
CMVpp65 - 19 (NQLQVQHTYFTGSEV)
NQLQVQHTYFTGSEV
14079-01 1 mg $193 cart inquire
CMVpp65 - 1 (MESRGRRCPEMISVL)
MESRGRRCPEMISVL
14028-01 1 mg $193 cart inquire
CMVpp65 - 20 (VQHTYFTGSEVENVS)
VQHTYFTGSEVENVS
14081-01 1 mg $193 cart inquire
CMVpp65 - 21 (YFTGSEVENVSVNVH)
YFTGSEVENVSVNVH
14082-01 1 mg $193 cart inquire
CMVpp65 - 22 (SEVENVSVNVHNPTG)
SEVENVSVNVHNPTG
14083-01 1 mg $193 cart inquire
CMVpp65 - 23 (NVSVNVHNPTGRSIC)
NVSVNVHNPTGRSIC
14084-01 1 mg $193 cart inquire
CMVpp65 - 24 (NVHNPTGRSICPSQE)
NVHNPTGRSICPSQE
14085-01 1 mg $193 cart inquire
CMVpp65 - 25 (PTGRSICPSQEPMSI)
PTGRSICPSQEPMSI
14086-01 1 mg $193 cart inquire
CMVpp65 - 26 (SICPSQEPMSIYVYA)
SICPSQEPMSIYVYA
14087-01 1 mg $193 cart inquire
CMVpp65 - 27 (SQEPMSIYVYALPLK)
SQEPMSIYVYALPLK
14088-01 1 mg $193 cart inquire
CMVpp65 - 28 (MSIYVYALPLKMLNI)
MSIYVYALPLKMLNI
14089-01 1 mg $193 cart inquire
CMVpp65 - 29 (VYALPLKMLNIPSIN)
VYALPLKMLNIPSIN
14090-01 1 mg $193 cart inquire
CMVpp65 - 2 (GRRCPEMISVLGPIS)
GRRCPEMISVLGPIS
14080-01 1 mg $193 cart inquire
CMVpp65 - 30 (PLKMLNIPSINVHHY)
PLKMLNIPSINVHHY
14092-01 1 mg $193 cart inquire
CMVpp65 - 31 (LNIPSINVHHYPSAA)
LNIPSINVHHYPSAA
14093-01 1 mg $193 cart inquire
CMVpp65 - 32(SINVHHYPSAAERKH)
SINVHHYPSAAERKH
14094-01 1 mg $193 cart inquire
CMVpp65 - 33 (HHYPSAAERKHRHLP)
HHYPSAAERKHRHLP
14095-01 1 mg $193 cart inquire
CMVpp65 - 34 (SAAERKHRHLPVADA)
SAAERKHRHLPVADA
14096-01 1 mg $193 cart inquire
CMVpp65 - 35 (RKHRHLPVADAVIHA)
RKHRHLPVADAVIHA
14097-01 1 mg $193 cart inquire
CMVpp65 - 36 (HLPVADAVIHASGKQ)
HLPVADAVIHASGKQ
14098-01 1 mg $193 cart inquire
CMVpp65 - 37 (ADAVIHASGKQMWQA)
ADAVIHASGKQMWQA
14099-01 1 mg $193 cart inquire
CMVpp65 - 38 (IHASGKQMWQARLTV)
IHASGKQMWQARLTV
14100-01 1 mg $193 cart inquire
CMVpp65 - 39 (GKQMWQARLTVSGLA)
GKQMWQARLTVSGLA
14107-01 1 mg $193 cart inquire
CMVpp65 - 3 (PEMISVLGPISGHVL)
PEMISVLGPISGHVL
14091-01 1 mg $193 cart inquire
CMVpp65 - 40 (WQARLTVSGLAWTRQ)
WQARLTVSGLAWTRQ
14108-01 1 mg $193 cart inquire
CMVpp65 - 41 (LTVSGLAWTRQQNQW)
LTVSGLAWTRQQNQW
14109-01 1 mg $193 cart inquire
CMVpp65 - 42 (GLAWTRQQNQWKEPD)
GLAWTRQQNQWKEPD
14110-01 1 mg $193 cart inquire
CMVpp65 - 43 (TRQQNQWKEPDVYYT)
TRQQNQWKEPDVYYT
14111-01 1 mg $193 cart inquire
CMVpp65 - 44 (NQWKEPDVYYTSAFV)
NQWKEPDVYYTSAFV
14112-01 1 mg $193 cart inquire
CMVpp65 - 45 (EPDVYYTSAFVFPTK)
EPDVYYTSAFVFPTK
14113-01 1 mg $193 cart inquire
CMVpp65 - 46 (YYTSAFVFPTKDVAL)
YYTSAFVFPTKDVAL
14114-01 1 mg $193 cart inquire
CMVpp65 - 47 (AFVFPTKDVALRHVV)
AFVFPTKDVALRHVV
14115-01 1 mg $193 cart inquire
CMVpp65 - 48 (PTKDVALRHVVCAHE)
PTKDVALRHVVCAHE
14116-01 1 mg $193 cart inquire
CMVpp65 - 49 (VALRHVVCAHELVCS)
VALRHVVCAHELVCS
14117-01 1 mg $193 cart inquire
CMVpp65 - 50 (HVVCAHELVCSMENT)
HVVCAHELVCSMENT
14119-01 1 mg $193 cart inquire
CMVpp65 - 51 (AHELVCSMENTRATK)
AHELVCSMENTRATK
14120-01 1 mg $193 cart inquire
CMVpp65 - 52 (VCSMENTRATKMQVI)
VCSMENTRATKMQVI
14121-01 1 mg $193 cart inquire
CMVpp65 - 53 (ENTRATKMQVIGDQY)
ENTRATKMQVIGDQY
14122-01 1 mg $193 cart inquire
CMVpp65 - 54 (ATKMQVIGDQYVKVY)
ATKMQVIGDQYVKVY
14123-01 1 mg $193 cart inquire
CMVpp65 - 55 (QVIGDQYVKVYLESF)
QVIGDQYVKVYLESF
14124-01 1 mg $193 cart inquire
CMVpp65 - 56 (DQYVKVYLESFCEDVKK)
DQYVKVYLESFCEDVKK
14125-01 1 mg $193 cart inquire
CMVpp65 - 57 (KVYLESFCEDVPSGK)
KVYLESFCEDVPSGK
14126-01 1 mg $193 cart inquire
CMVpp65 - 58 (ESFCEDVPSGKLFMH)
ESFCEDVPSGKLFMH
14127-01 1 mg $193 cart inquire
CMVpp65 - 59 (EDVPSGKLFMHVTLG)
EDVPSGKLFMHVTLG
14128-01 1 mg $193 cart inquire
CMVpp65 - 5 (PISGHVLKAVFSRGD)
PISGHVLKAVFSRGD
14118-01 1 mg $193 cart inquire
CMVpp65 - 60 (SGKLFMHVTLGSDVE)
SGKLFMHVTLGSDVE
14130-01 1 mg $193 cart inquire
CMVpp65 - 61 (FMHVTLGSDVEEDLT)
FMHVTLGSDVEEDLT
14131-01 1 mg $193 cart inquire
CMVpp65 - 62 (TLGSDVEEDLTMTRN)
TLGSDVEEDLTMTRN
14132-01 1 mg $193 cart inquire
CMVpp65 - 63 (DVEEDLTMTRNPQPF)
DVEEDLTMTRNPQPF
14133-01 1 mg $193 cart inquire
CMVpp65 - 64 (DLTMTRNPQPFMRPH)
DLTMTRNPQPFMRPH
14134-01 1 mg $193 cart inquire
CMVpp65 - 65 (TRNPQPFMRPHERNG)
TRNPQPFMRPHERNG
14144-01 1 mg $193 cart inquire
CMVpp65 - 66 (QPFMRPHERNGFTVL)
QPFMRPHERNGFTVL
14145-01 1 mg $193 cart inquire
CMVpp65 - 67 (RPHERNGFTVLCPKN)
RPHERNGFTVLCPKN
14146-01 1 mg $193 cart inquire
CMVpp65 - 68 (RNGFTVLCPKNMIIK)
RNGFTVLCPKNMIIK
14147-01 1 mg $193 cart inquire
CMVpp65 - 69 (RNGFTVLCPKNMIIK)
TVLCPKNMIIKPGKI
14148-01 1 mg $193 cart inquire
CMVpp65 - 6 (HVLKAVFSRGDTPVL)
HVLKAVFSRGDTPVL
14129-01 1 mg $193 cart inquire
CMVpp65 - 70 (PKNMIIKPGKISHIM)
PKNMIIKPGKISHIM
14150-01 1 mg $193 cart inquire
CMVpp65 - 71 (IIKPGKISHIMLDVA)
IIKPGKISHIMLDVA
14151-01 1 mg $193 cart inquire
CMVpp65 - 72 (GKISHIMLDVAFTSH)
GKISHIMLDVAFTSH
14152-01 1 mg $193 cart inquire
CMVpp65 - 73 (HIMLDVAFTSHEHFG)
HIMLDVAFTSHEHFG
14153-01 1 mg $193 cart inquire
CMVpp65 - 74 (DVAFTSHEHFGLLCP)
VAFTSHEHFGLLCP
14154-01 1 mg $193 cart inquire
CMVpp65 - 75 (TSHEHFGLLCPKSIP)
TSHEHFGLLCPKSIP
14165-01 1 mg $193 cart inquire
CMVpp65 - 76 (HFGLLCPKSIPGLSI)
HFGLLCPKSIPGLSI
14166-01 1 mg $193 cart inquire
CMVpp65 - 77 (LCPKSIPGLSISGNL)
LCPKSIPGLSISGNL
14167-01 1 mg $193 cart inquire
CMVpp65 - 78 (SIPGLSISGNLLMNGKK)
SIPGLSISGNLLMNGKK
14168-01 1 mg $193 cart inquire
CMVpp65 - 79 (LSISGNLLMNGQQIFKK)
LSISGNLLMNGQQIFKK
14169-01 1 mg $193 cart inquire
CMVpp65 - 7 (AVFSRGDTPVLPHET)
AVFSRGDTPVLPHET
14149-01 1 mg $193 cart inquire
CMVpp65 - 80 (GNLLMNGQQIFLEVQKK)
GNLLMNGQQIFLEVQKK
14171-01 1 mg $193 cart inquire
CMVpp65 - 81 (MNGQQIFLEVQAIRE)
MNGQQIFLEVQAIRE
14172-01 1 mg $193 cart inquire
CMVpp65 - 82 (QIFLEVQAIRETVEL)
QIFLEVQAIRETVEL
14173-01 1 mg $193 cart inquire
CMVpp65 - 83 (EVQAIRETVELRQYD)
EVQAIRETVELRQYD
14174-01 1 mg $193 cart inquire
CMVpp65 - 84 (IRETVELRQYDPVAA)
IRETVELRQYDPVAA
14175-01 1 mg $193 cart inquire
CMVpp65 - 85 (VELRQYDPVAALFFF)
VELRQYDPVAALFFF
14176-01 1 mg $193 cart inquire
CMVpp65 - 86 (QYDPVAALFFFDIDL)
QYDPVAALFFFDIDL
14177-01 1 mg $193 cart inquire
CMVpp65 - 87 (VAALFFFDIDLLLQRKK)
VAALFFFDIDLLLQRKK
14178-01 1 mg $193 cart inquire
CMVpp65 - 88 (FFFDIDLLLQRGPQY)
FFFDIDLLLQRGPQY
14179-01 1 mg $193 cart inquire
CMVpp65 - 89 (IDLLLQRGPQYSEHP)
IDLLLQRGPQYSEHP
14180-01 1 mg $193 cart inquire
CMVpp65 - 8 (RGDTPVLPHETRLLQ)
RGDTPVLPHETRLLQ
14170-01 1 mg $193 cart inquire
CMVpp65 - 90 (LQRGPQYSEHPTFTS)
LQRGPQYSEHPTFTS
14182-01 1 mg $193 cart inquire
CMVpp65 - 91 (PQYSEHPTFTSQYRI)
PQYSEHPTFTSQYRI
14183-01 1 mg $193 cart inquire
CMVpp65 - 92 (EHPTFTSQYRIQGKL)
EHPTFTSQYRIQGKL
14184-01 1 mg $193 cart inquire
CMVpp65 - 93 (FTSQYRIQGKLEYRH)
FTSQYRIQGKLEYRH
14185-01 1 mg $193 cart inquire
CMVpp65 - 94 (YRIQGKLEYRHTWDR)
YRIQGKLEYRHTWDR
14186-01 1 mg $193 cart inquire
CMVpp65 - 95 (GKLEYRHTWDRHDEG)
GKLEYRHTWDRHDEG
14187-01 1 mg $193 cart inquire
CMVpp65 - 96 (YRHTWDRHDEGAAQG)
YRHTWDRHDEGAAQG
14188-01 1 mg $193 cart inquire
CMVpp65 - 97 (WDRHDEGAAQGDDDV)
WDRHDEGAAQGDDDV
14189-01 1 mg $193 cart inquire
CMVpp65 - 98 (DEGAAQGDDDVWTSG)
DEGAAQGDDDVWTSG
14190-01 1 mg $193 cart inquire
CMVpp65 - 99 (AQGDDDVWTSGSDSD)
AQGDDDVWTSGSDSD
14191-01 1 mg $193 cart inquire
CMVpp65 - 9 (PVLPHETRLLQTGIH)
PVLPHETRLLQTGIH
14181-01 1 mg $193 cart inquire
CMV pp65 peptide
SVLGPISGHVLKAVF
14026-01 1 mg $120 cart inquire
CMV Tegument Protein pp65 (116 - 129)
LPLKMLNIPSINVH
14027-01 1 mg $199 cart inquire
[Cys] - Tat (44 - 56)
CGISYGRKKRRQRR
14011-01 1 mg $188 cart inquire
Cytomegalovirus (CMV) CTL Epitope (pp65)
QYDPVAALF
14202-01 1 mg $183 cart inquire
Cytomegalovirus Proteinase Substrate
RGVVNASSRLA
14203-01 1 mg $183 cart inquire
Dengue 1 Fragment, VGIGNRDFV  NEW
VGIGNRDFV
13665-01 1 mg $210 cart inquire
Dengue 1 Polyprotein (886 - 891); Non - structural Protein - 1 (111 - 116)
HKYSWK
14204-01 1 mg $161 cart inquire
Dengue 2 Virus Fragment, IGISNRDFV  NEW
IGISNRDFV
13666-01 1 mg $210 cart inquire
E7 (43–62), HPV Oncoprotein
GQAEPDRAHYNIVTFCCKCD
13660-01 1 mg $250 cart inquire
E7 (43–77), HPV Oncoprotein
GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR
13661-01 1 mg $445 cart inquire
EBNA1 (407 - 417)
HPVGEADYFEY
14205-01 1 mg $161 cart inquire
Epstein - Barr Virus Nuclear Antigen 3 (596 - 604); SVR
SVRDRLARL
14206-01 1 mg $380 cart inquire
Gamma Interferon (95 - 125), IFN - γ (95 - 125), mouse
AKFEVNNPQVQRQAFNELIRVVHQLLPESSL
14207-01 1 mg $331 cart inquire
Gamma Interferon (95 - 132), IFN - g (95 - 132), mouse
AKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSR
14208-01 1 mg $500 cart inquire
gB(RGD)
RGDTFQTSSSPTPPGSSS
14209-01 1 mg $210 cart inquire
HA (126 - 138), Influenza Hemagglutinin (126 - 138)
HNTNGVTAASSHE
14210-01 1 mg $183 cart inquire
HBcAg (HBV) (18 - 27)
FLPSDFFPSV
13632-01 1 mg $215 cart inquire
HBcAg (HBV) (18 - 27)
FLPSDFFPSV
14211-01 1 mg $177 cart inquire
HBV Core (107 - 115)
CLTFGRETV
13636-01 1 mg $220 cart inquire
HBV Core (107 - 115)
CLTFGRETV
14212-01 1 mg $183 cart inquire
HBVcore14, (HBA31)
STLPETTVVRR
13639-01 1 mg $220 cart inquire
HBVcore14, (HBA31)
STLPETTVVRR
14213-01 1 mg $183 cart inquire
HBVenv (183–191)
FLLTRILTI
13635-01 1 mg $220 cart inquire
HBVenv (183–191)
FLLTRILTI
14214-01 1 mg $183 cart inquire
HBVenv (335 - 343)
WLSLLVPFV
13634-01 1 mg $220 cart inquire
HBVenv (335 - 343)
WLSLLVPFV
14215-01 1 mg $83 cart inquire
HBVpol455
GLSRYVARL
14216-01 1 mg $171 cart inquire
HBVpol455  HBV polymerase (455 - 463)
GLSRYVARL
13633-01 1 mg $210 cart inquire
HBVpol502, HBV polymerase (502 - 510)
KLHLYSHPI
13637-01 1 mg $225 cart inquire
HBVpol502, HBV polymerase (502 - 510)
KLHLYSHPI
14217-01 1 mg $193 cart inquire
HBVpol575, HBV polymerase (575 - 583)
FLLSLGIHL
14218-01 1 mg $193 cart inquire
HBVpol655, HBV polymerase (655 - 663)
ALMPLYACI
13638-01 1 mg $230 cart inquire
HBVpol655, HBV polymerase (655 - 663)
ALMPLYACI
14219-01 1 mg $199 cart inquire
HCV - 1 e2 Protein (484 - 499)
PYCWHYPPKPCGIVPA
13658-01 1 mg $230 cart inquire
HCV - 1 e2 Protein (484 - 499)
PYCWHYPPKPCGIVPA
14222-01 1 mg $199 cart inquire